~ CATALOGUE
OF
SANSKRIT MANUSCRIPTS
IN THE BODLEIAN LIBRARY
APPENDIX
TO VOL. I (TH. AUFRECHT S CATALOGUE)
BY
ARTHUR BERRIEDALE KEITH, B.C.L., M.A.
LATE SCHOLAR OF BALLIOL COLLEGE, OXFORD; BODEN SANSKRIT SCHOLAR, 1 898 ;
OF THE INNER TEMPLE, BARRISTER-AT-LAW
OXFORD
AT THE CLARENDON PRESS
1909
HENRY FROWDE, M. A.
PUBLISHER TO THE UNIVERSITY OF OXFORD
LONDON, EDINBURGH, NEW YORK
TORONTO AND MELBOURNE
INTRODUCTORY NOTE
I trust that all readers of this have long since seen vol. II of the catalogue
of our Sanskrit MSS. When that volume had been completed by Mr. Keith (in
continuation of the work of Prof. Winternitz), I asked him to prepare a supplement
to Prof. Aufrecht’s vol. I, equating that volume in points of technical description
with vol. II. This Appendix (written in 1901 and 1902) is the result, and I need
only add that the proofs have been read not only by Mr. Keith, but by Dr. A. E.
Cowley, Fellow of Magdalen College, one of the two Sub-Librarians, who has
also carried on the necessary correspondence with the cataloguer and with the
University Press.
E. W. B. NICHOLSON
Bodley’s Librarian
PALAEOGRAPHICAL INDEX
OF DATED MSS.
AND OF UNDATED MSS. BEFORE A. D. 1500
No. in Catalogue
& Shelfmark
Date A.D.
Scribe & Place
167 .
MS. "Walker i9i b
137°
826 .
MS. Fraser 27 .
1385 • • •
Dhanaka at Borasiddhima-
hasthana
842 -
B 44 . MS. Fraser 5
1397 • • •
Jyotirdainodara
809 ,
810 . MS. Fraser 2
1406, 1407 .
Mahammelaka, son of Maham-
saravana, at Devapattana
826 .
MS. Fraser 27 .
1413 . . .
at Naradiyamahasthana
805 .
MS. Fraser 8
*433
830 .
MS. Fraser 14 .
1434 . . .
Govinda at Thankariagrama
208 .
MS. Walker 190®
1442 . . .
Dharanldhara at Nattapatta-
grama
833 .
MS. Fraser 16 .
1443
815 .
MS. Fraser 15 .
1456 • • .
Kahnaka, son of Alava, at
Ranapuradurga
451 .
MS. Walker i8i e
1467 . . .
Nalha.
817 .
MS. Fraser 17 .
1478 • . .
Camp&laga at Kadanapura
103 .
MS. Wilson 355
15th cent.
209 .
MS. Walker 208®
15th cent. .
526 .
MS. Wilson 27 7 b
15th cent. .
820 .
MS. Fraser 9
15th cent. .
822 .
MS. Fraser 10 .
15th cent. .
825 .
MS. Fraser 18 .
15th cent.
832 .
MS. Fraser 25 .
15th cent.
834 .
MS. Fraser 13 .
15 th cent. .
840 .
MS. Fraser 6
15th cent.
841 .
MS. Fraser 4
15th cent.
785 .
MS. Walker i28 b
1513 . . .
at Srlpattana.
829 .
MS. Fraser 24 .
I 5 H • • •
Vacharau, son of Saranga-
dhara, at Stambhatlrtha
520 .
MS. Wilson 325
1525 . . .
Vifmusarman
523 .
MS. Wilson 275
1525 . . .
Visnusarman
848 .
MS. Fraser 20 .
1529 . . .
Kahnaka at Khambhati
851 .
MS. Fraser 19 .
1529 . . .
Kahnaka at Khambhayata
852 .
MS. Fraser 21 .
1530 . . .
Kahnaka at Khambhayata
776 .
MS. Walker i9o b
154°
806 .
MS. Fraser 8
1540
522 .
MS. Wilson 2 73 b
1542 . . .
Garigadasa and Narahari
845 .
MS. Fraser 11 .
1562 . . .
Gautamaka at Stambhatlrtha
824 .
MS. Walker 217
1577 • • •
Vitthalabhatta
724 .
MS. Mill 75 . .
1587
177 .
MS. Walker 182c
1589 • • •
Mahimasundara at Rinlpura
219 .
MS. Walker 128c
1594 • • •
Haramjit
Josihara, son of Rama
220.
MS. Walker 171®
1613 . . .
183 .
MS. Walker 210c
1622
799 .
MS. Walker 1910
1625 . . .
DevajI at Rupapura
Character of
Writing where
not Ordinary
Devanagari
Jaina Devanagari
Jaina Devanagari
Jaina Devanagari
Jaina Devanagari
J aina Devanagari
Jaina Devanagari
Jaina Devanagari
Jaina Devanagari
Material
WHERE NOT
Ordinary
Paper
a 3
VI
DATED MSS., AND UNDATED MSS. BEFORE A.D. 1500
No. in Catalogue
& Shelfhark
Date A.D.
Scribe & Place
Character of
Writing where
not Ordinary
DevanIoari
Material
where not
Ordinary
Paper
793.
MS. Walker 2i3 b
583.
MS. Wilson 507
485.
MS. Wilson 336
326.
MS. Marsh 328b
335.
MS. Marsh 328°
755.
MS. Marsh 328°
556.
MS. Wilson 449b
606.
MS. Walker 2C>5 e
701.
MS. Wilson 152b
538.
MS. Wilson 389
709.
MS. Mill 74“ .
747.
MS. Walker i82 a
193.
MS. Mill 73 . .
502.
MS. Walker 2 2 2 b
329.
MS. Walker 2 o6 b
570.
MS. Mill 61“ .
561.
MS. Mill 61b .
549.
MS. Wilson 478b
87.
MS. Wilson 117
555.
MS. Mill 13
470.
MS. Walker 192°
422.
MS. Wilson 404
781.
MS. Wilson 427
168.
MS. Wilson 243b
257.
MS. Wilson 31 i a
423.
MS. Walker 2056
213.
MS. Walker 181b
636.
MS. Walker 172
109.
MS. Wilson 108
391.
MS. Wilson 146
58.
MS. Walker 2o6 ft
754.
MS. Walker i8i«l
119.
MS. Walker i8i a
173.
MS. Wilson 312
253.
MS. Wilson 233
86.
MS. Wilson 22 .
752.
MS. Walker i8i f
96.
MS. Mill 105b .
540.
MS. Mill 46c .
95.
MS. Wilson 21 .
836, 837. MSS. Mill 59,
60
200.
MS. Wilson 498
695.
MS. Wilson 152°
590.
MS. Wilson 8
5, 6,
7 , 9, 13. MSS. Wilson
135, 136, 137. 139, M3
238.
MS. Wilson 205c
543.
MS. Wilson 470 .
1640 . . .
Pitambara, son of Bhata
S'ivadasa
1643 . . .
Nanugamgaharu, son of Dur-
gadasa
1647
1653
1653
1653
1655 . . .
Sahasrakirana at Visvesvara-
rajadhanl
1659 . . .
Jaina Devanagarl
1665 . . .
Yadavendra .
Bengali
1668
1669 . . .
Madhavaji
1670 . . .
Blia^a Lllara at Javaragrama
1672
1673 . . .
Trivikramabhatta Satha
•675
1677 . . .
Vinayasundara Syadvadin
Jaina Devanagarl
1678 . . .
Vinayasundara Syadvadin (?)
J aina Devanagarl
1681
1686
1687
1692 . . .
Sadiisiva, son of Pitambara, at
Prayfiga
1695 . . .
1696 . . .
Dhanasundara at Jalalapura
Ranadeva, son of Sara, at
SahajahSnavad
1697 . . .
Giridhara
1697 . . .
(Lallesvara at Kalkita cor¬
rected it in 1824)
1698 . . .
Kusalasagara at Suryapura .
Jaina Devanagarl
1702
1702
1703
1703 & 1827
Vrndavanasarman and Kaslna-
Bengali
thadevasarmnn
1708
1708 . . .
J aina Devanagarl
1709 • . .
1709 . . .
Brahmadeva
J aina Devanagarl
1710 . . .
Bengali
1711 . . .
Bengali
1711 . . .
Devacandra at Navanagara
1717 • • •
Naudikesvara
1728
1729 . . .
Janmamani at Srlnagara
‘732-1734 •
Ramacandra, son of Raghu-
natha Ayacita
x 734 • • •
Kasluatha Somana
1734 . . .
Ramatanu.
Bengali
1736 . . .
Gopaladasa at S'akimanavar-
Bengali
1736-1739 •
dipa
Bhisarldasa (?)
1737 • . .
Mohanacanda at Sridharola-
1738 . . .
nagara
at Jaj&lapura
DATED MSS., AND UNDATED MSS. BEFORE A. D. 1500
vii
802.
808.
828.
847.
110 .
56.
463.
669.
246.
723.
43.
61.
373.
147.
637.
222 .
796.
125.
140.
102 .
753.
92.
59.
113.
124.
127.
462.
465.
500.
501.
592.
598.
607.
611.
617.
57.
63.
278.
641.
38.
186.
420.
232.
237.
379.
382.
386.
605.
649.
169.
240.
211 .
518.
608.
610.
No. nr Catalogue
& Shelfmark
MS. Fraser 7
MS. Fraser 32 .
MS. Fraser 33 .
MS. Fraser 30 .
MS. Wilson 107 .
MS. Mill 4 . .
MS. Walker 2 os b
MS. Wilson 204 a
MS. Walker 152 °
MS. Mill 102
MS. Wilson 102
MS. Wilson 127 b
MS. MiU no .
MS. Wilson 392
MS. Wilson 254
MS. Walker 173
MS. Wilson 33 7 C
MS. Walker i 57 d
MS. Wilson 119 ®
MS. Wilson 118
MS. Wilson 127*
MS. Walker i 8 i c
MS. Walker 2o8 d
MS. Walker i66 b
MS. Walker 204
MS. Walker 144®
MS. Walker I32 d
MS. Walker 179c
MS. Walker i 79 d
MS. Wilson 512 ®
MS. Wilson 332 11
MS. Walker 123
MS. Walker i 37 b
MS. Walker 180*
MS. Walker 180®
MS. Walker i8o d
MS. Walker i 66 a
MS. Wilson 356
MS. Walker 200 f
MS. Walker 129®
MS. Walker 132°
MS. Walker 200®
MS. Walker 200s
MS. Walker 200 d
MS. Walker i 2 9 b
MS. Walker i 6 i b
MS. Walker 131*
MS. Walker 179®
MS. Walker 20o b
MS. Walker 200®
MS. Walker 179®
MS. Walker i 29 d
MS. Walker 129°
MS. Walker 189
MS. Walker 2oi b
MS. Walker 201°
Date A.D.
Scribe & Place
Character of
WRITING WHERE
not Ordinary
Devanagari
Material
where not
Ordinary
Paper
1739 • • •
Rajadharaji.
Jaina DevanSgarl
1739 • • •
Rajadharaji.
Jaina Devanagarl
*739 • • •
RajadharajI.
Jaina DevanSgarl
*739 • • •
1740 • • •
Rajadharaji.
Puranda at KasI
Jaina Devanagarl
1741 . . .
1741 . . .
174* • • •
Prabhujl (?)
Gojyotisyahotribhattatmaja at
Kalaghafcti
Bengali
*743 • • •
1744 • • •
1748 . . .
at Anjanapura.
Bhafca Devarama (?)
Lalhakatare(?) at Rathapu(ra)
Jaina Devanagarl
*749 • • •
*749 • • •
*755 (?)
1760 . . .
1760(1)
1761
1761 . . .
1762 . . .
1762
1763 . . •
Khamdenyaphulamvarlphara(?
Hariharananda
Kailasa Pandita
Bhata Vrnirama
Govardhana at Ramaghata in
KasI
at KasI
*763 • . .
1766(1)
Rupavardhana .
Jaina Devanagarl
* 77 ° • . .
Bhudeva .
J aina Devanagari
1770 • • •
1770
Bhudeva .
Jaina Devanagarl
i 77 o • ♦ .
Bhudeva (?).
J aina DevanSgarl
1770 • • •
Bhudeva .
Jaina Devanagarl
OOOOOOOO
Bhudeva.
Kaladhara at GangadhSrapura
Jaina DevanSgarl
'
1771 . . .
1772 («)
Bhudeva .
J aina Devanagarl
1772 . . .
Bhudeva .
Jaina DevanSgarl
*772 . . .
Bhudeva .
J aina DevanSgarl
*774 • . •
Bhudeva .
J aina Devanagarl
*774 • • •
Bhudeva .
J aina Devanagarl
*775 • • •
Bhudeva .
J aina Devanagarl
1776 . . .
Bhudeva .
Jaina Devanagarl
1776 . . .
Bhudeva .
J aina Devanagarl
1776 . . .
Bhudeva .
J aina Devanagarl
1776 . . .
Bhudeva .
J aina Devanagarl
1776 . . .
Bhudeva .
Jaina Devanagarl
1776 . . .
Bhudeva.
J aina Devanagarl
1776 . . .
Bhudeva .
J aina Devanagarl
1779 • • •
Bhudeva .
J aina Devanagarl
1779 • • •
Bhudeva .
J aina Devanagarl
1780 . . .
1780
1780 . . .
1780
Bhudeva .
Durlabharama
J aina Devanagarl
DATED MSS., AND UNDATED MSS. BEFORE A. D. 1500
No. in Catalogue
& Shelfmark
Scribe & Place
Character of
Writing where
not Ordinary
DevanagarI
Material
WHERE NOT
Ordinary
Paper
614 . MS. AValker 201* . .
593 - 595 . MSS. Wilson 179-
181
8, 13 . MSS. Wilson 138, 143
8. MS. AVilson 138 . .
30 . MS.
98 . MS.
710 . MS.
234 . MS.
726 . MS.
239 . MS.
425 . MS.
537 . MS.
551 . MS
703 . MS
31 . MS.
74 . MS.
120 - 122 .
97
225 . MS.
227 . MS.
242 . MS.
367 . MS.
811 , 812 .
216
697 . MS,
698 . MS
700 . MS,
505 . MS
687 . MS.
741 , 742 .
299
835 . MS.
25 . MS.
137 . MS.
274 . MS.
532 . MS.
609 . MS.
646 . MS.
404 . MS.
688. MS.
AA r alker 179 b
AA r alker i2 9 ft
A\ r ilson 527
AVilson 4266
AVilson 394b
AVilson 520.
AVilson 463.
AA 7 alker 2 2 2 a
A\ 7 ilson 426 a
Wilson 153°
AA’alker 202
AValker 130
MSS. AVilson
AValker i52 d .
AValker 152® .
Walker 152^ .
AVilson 2 8o a .
MSS. Walker 21
AVilson 162®
, AVilson i62 b
AVilson 152°
AVilson 332“
AVilson 30b . ,
MSS. Wilson 298,
Wilson 534
Walker 167
Wilson 490
AVilson 308®
AVilson 276
Wilson i8o a
AVilson 206
AVilson 157
249 .
MS. Wilson 487b
*iy v *
1800
336 .
MS. AVilson 240
1800
619 .
MS. AVilson 493°
1800
662 .
MS. Wilson 29b
1800 .
790 .
MS. Walker i59 a
1800 .
73 .
MS. AVilson 105
1801 .
133 .
MS. Wilson 351
1801
134 .
MS. Wilson 350
1801
301 .
MS. Wilson 308
l8oi
303 .
MS. AVilson 166 b
l8oi
748 .
MS. Wilson 293
l8oi
426 .
MS. Walker 151®
1802 .
651 ,
652 . MSS. Walker,
174 , 175
1802 .
99 .
MS. Wilson 486®
•1
1804
1780
1781
1782 . .
1782 . .
1782 . .
1782 . .
1784
1787
1788
1790 . .
1790
1790
1790
1790
1791 . .
1792 . .
1792
1794
1794
1794
1794 . .
1794 . .
1795 • •
1795 • •
1795 • •
1796 . .
1796
1796
1796 . .
1798 . .
1798
1 799
1799
799
799 • •
1790-1800
Ghanasyama at Bhadrapura
Suvarna Tripatkin at Bhad¬
rapura
Bhudeva .
Bhudeva .
Pitambaradasa in Vj-ndavana
Joslkevalarama ,
Haragyiina at KasI
Kalabkavanedasa
J agannathadevasarman
Ramatanudevasaruian .
Ramatanu
Jivar&ma
at Avanti
Joslkevalarama at Madavl-
vlmdara
DhTresvara at Blilthi .
Ramatanudevasarman .
Parasurama at Amadavada
Mahadeva(l)
KamnajI
Uttararama at Amadavada
Jaina Devanagari
J aina DevanagarI
J aina DevanagarI
Bengali
Bengali
Jaina DevanagarI
Bengali
Bengali
Bengali
DATED MSS., AND UNDATED MSS. BEFORE A. D. 1500
IX
No. IN Catalogue
& Shelfmark
Date A. D.
Scribe & Place
436.
MS. Wilson 4i4 a
1804 . . .
437.
MS. Wilson 414°
1804
440.
MS. Wilson 4i4 b
1804 . . .
541.
MS. Wilson 88 .
1805 . . .
Sadasiva at Puskaraksetra
354.
MS. Wilson 2 8o b
1806
798.
MS. Wilson 386
1807
32.
MS. Wilson 106
1809
417.
MS. Wilson 176
1809 . . .
544.
MS. Mill 62c .
1810
642.
MS. Wilson 202 .
1810 . . .
S'ankaralala
418.
MS. Wilson 3i4 a
1811
71.
MS. Mill 4 2 a . .
1812 . . .
Go 0 at Hanumanagiri
149.
MS. Wilson 46 .
1812 . . .
424.
MS. Wilson 252.
1812
455.
MS. Wilson 50 .
1812
456.
MS. Wilson 53 .
1812 . . .
681.
MS. Wilson 36 a .
1812 . . .
Jagannathasnrman ....
691 .
MS. Wilson 34 b
1812 . . .
704.
MS. Wilson 36 b
1812 . . .
705.
MS. Wilson 35 b .
1812 . . .
204.
MS. Wilson 346
1813
372.
MS. Wilson 201
1813
648.
MS. Wilson 203 b
1813 . . .
Pltambara Bhattacarya . .
650.
MS. Wilson 218
1813 . . .
Pltambarasarman ....
672 .
MS. Wilson 34 a .
1813 . . .
Jagann&thasarman (?) . . .
685.
MS. Wilson 34 c .
1813 . . .
JHgannathasannan ....
692 .
MS. Wilson 203 11
1813 . . .
Pltambara Bhattacarya . .
714.
MS. Wilson 154
1813 . . .
Jagannathasaiman ....
766,767. MSS. Wilson
287!
1813
79-
81. MSS. Wilson
123
121-
1813-1816 .
Vanivanda at KasI
154.
MS. Wilson 3oo b
1814 . . .
Pltambarasarman ....
160 .
MS. Wilson 3oo a
1814 . . .
Pltambara Bhattacarya . .
376.
MS. Wilson 14 .
1814 . . .
655.
MS. Wilson i59 a
1814 . . .
657.
MS. Wilson i59 b
1814 . . .
236.
MS. Wilson 236 .
1815
486.
MS. Wilson 333* 1
1815 • . .
Pltambarasarman
659.
MS. Wilson 214 .
1815
665-
667. MSS. Wilson 215-
1815 • . .
S'ankaralala
22.
MS. Mill 112 a .
1817 . . .
Hatha Pandita in Kasmlr
26.
MS. Mill 112C .
1817 . . .
Hatha Pandita in Kasmlr
28.
MS. Mill 112 b .
1817 . . .
Hatha Pandita in Kasmlr
33.
MS. Millii 2 <i .
1817 . . .
Hatha Pandita in Kasmlr
35.
MS. Mill 112® .
1817 . . .
Hatha Pandita in Kasmlr
146.
MS. Mill 112 n .
1817 . . .
Hatha Pandita in Kasmlr
152.
MS. Mill 112k .
1817 . . .
Hatha Pandita in KaSmir
153.
MS. Mill 112P .
1817 . . .
Hatha Pandita in Kasmlr
161.
MS. Mill n 2 f .
1817 . . .
Hatha Pandita in Kasmlr
162.
MS. Mill 11 2 i .
1817 . . .
Hatha Pandita in Kasmlr
164.
MS. Mill ii2* .
1817 . . .
Hatha Pandita in Kasmlr
165.
MS. Mill 11 2 *i .
1817 . . .
Hatha Pandita in Kasmlr
166.
MS. Mill 112 m .
1817 . . .
Hatha Pandita in Kasmlr
731.
MS. Mill 1128 .
1817 . . .
Hatha Pandita in Kasmlr
732.
MS. Mill 112 b .
1817 . . .
Hatha Pandita in KaSmir
733.
MS. Mill 112 1
1817 . . .
Hatha Pandita in Kasmlr
Character of
Writing where
not Ordinary
Devanagari
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Bengali
Material
where not
Ordinary
Paper
Palm-leaves
X
DATED MSS., AND UNDATED MSS. BEFORE A. D. 1500
Character of
Material
No. in Catalogue
& SlIELFMARK
Date A. D.
Scribe & Place
Writing where
not Ordinary
WHERE NOT
Ordinary
Devanagari
Paper
352 .
MS. Wilson 283“ . .
1819 . . .
Vecanalala
508 .
MS. Wilson 493 b . .
1819
546 .
MS. Mill 62*1. . . .
1819
660 .
MS. Wilson 2 9 ft . . .
1819 . . .
Devaniltha.
Bengali
671 .
MS. Wilson 2 5 b • • .
1819 . . .
Devanatha.
Bengali
421 .
MS. Wilson 415° . .
1820
427 .
MS. Wilson 2 53 b . .
1820
452 .
MS. Wilson 4 o8 b . .
1820 . . .
Mohanarama
482 .
MS. Wilson 301 b . .
1820
624 .
MS. Wilson 34 8 a . .
1820
24 .
MS. Wilson 255 . .
1821
106 .
MS. Wilson 101 . .
1821
42 .
MS. Wilson 129 . .
1821
132 .
MS. Wilson 128 . .
1821
205 .
MS. Wilson 347 . .
1821 . . .
Haralala at Kasi
210.
MS. Wilson 245 11 . .
182 1
229 .
MS. Wilson 2 45 b . .
1821 . . .
Kasinatha
262 .
MS. Wilson 165c . .
1821
261 .
MS. Wilson i66 a . .
1821
264 .
MS. Wilson 232 a . .
1821
265 .
MS. Wilson 23o e . .
1821
266 .
267 .
MS. Wilson i66<J . .
MS. Wilson 23i a . .
1821 . . .
1821 (?)
Lalladiksita (?)
271 .
MS. Wilson 23i b . .
1821
289 .
MS. Wilson i65 b . .
1821
293 .
MS. Wilson i68 a . .
1821
296 .
MS. Wilson i68 b . .
1821
297 .
MS. Wilson 165 a . .
1821
300 .
MS. Wilson 232° . .
1821
303 .
MS. Wilson i66 b . .
1821
304 .
MS. Wilson 492® . .
1821 . . .
Parasulala
307 .
MS. Wilson 230 b . .
1821
308 .
MS. Wilson 22 8 a .
1821
311 .
MS. Wilson 5148 .
1821 . . .
Ramacandra at Kasi
340 .
MS. Wilson 308° . .
1821
371 .
MS. Wilson 256b . .
1821
433 .
MS. Wilson 334
1821
444 .
MS. Wilson 2 56 b . .
1821
489 .
MS. Wilson 246 . .
1821 . . .
Madhorama
491 .
MS. Wilson 243 a . .
182 1
517 .
535 .
MS. Wilson 237 a .
MS. Wilson 90 . .
1821 . . .
1821
Ramanarayana at Kasi
536 .
MS. Wilson 183
1821
568 .
MS. Wilson 48i b .
1821 . . .
Ramacandra
622 .
MS. Wilson 171 . .
1821 . . .
Laksamana
689 .
693 .
789 .
797 .
250 .
MS. Wilson 33 b . .
MS. Wilson 33 81 ,
MS. Wilson 315
MS. Wilson 425 . ;
MS. Wilson 167a . .
1821 . . .
1821 . . .
1821 . . .
1821 . . .
1822
Ramatanuvidyavagisa .
Dayacandra Laghupaudita
Tokamani
Bengali
Bengali
315 .
MS. Wilson 391
1822 . . .
Sadasukhamisra at Indra-
490 .
MS. Wilson 164 . .
1822 (?)
1822 . . .
1823
prastha
716 . MS. Wilson 24°
82 - 85 . MSS. Mill 133-
Ramasarraan.
Bengali
136
178 .
MS. Mill 95. . ,
1823
298 .
MS. Wilson 169 . .
1823
DATED MSS., AND UNDATED MSS. BEFORE A. D. 1500
xi
No. in Catalogue
& Shelfmark
Date A. D.
Scribe & Place
Character of
Writing where
not Ordinary
DevanagarI
Material
where NOT
Ordinary
Paper
321-
324. MSS. Wilson 316-
1824
3*9
328.
MS. Wilson 327
1824
699.
MS. Wilson 23 d
1824
743.
MS. Wilson 294
1824
818.
MS. Wilson 532
1824 . . .
Haraka
471.
MS. Mill 49 . . .
1825
679.
MS. Wilson 35 a
1825 . . .
Hara.
Bengali
682.
MS. Wilson 3i a .
1825 . . .
Bengali
686.
MS. Wilson 33 b
1825 . . .
Hara.
Bengali
694.
MS. Wilson 3i b .
1825 . . .
Bengali
702.
MS. Wilson 33 e
1825 . . .
SiSuramadevasarman . . .
Bengali
62.
MS. Wilson 125
1826
77.
MS. Wilson 124
1826
696.
MS. Wilson 23°
1826 . . .
CandraSekharadevaSarman .
Bengali
717.
MS. Wilson 204 b .
1826
738, 739. MSS. Wilson 289,
1826
290
184.
MS. Mill 44 . . .
1827
390.
MS. Wilson 149® .
1827 . . .
KaSlnathadevaSarman . .
Bengali
392.
MS. Wilson 13 . .
1827 . . .
KasinathadevaSarmnn . .
Bengali
700.
MS. Wilson 152® .
1827 . . .
Bengali
401.
MS. Wilson 12 . .
1828 . . .
Bengali
676.
MS. Wilson i52 d .
1830 . . .
Bengali
683.
MS. Wilson 33 d
1830 . . .
Bengali
784.
MS. Wilson 428
1831
675.
MS. Wilson 33c
1832 . . .
Sisur&madevasarman . . .
Bengali
690.
MS. Wilson 23*
1832 . . .
CandrasekharadevaSarman .
Bengali
795.
MS. Mill 4 2 d . .
1832 (1)
464.
MS. Wilson 2 2g b .
1833 . . .
Madhavarama
466.
MS. Wilson 225 11 .
1833 . . .
Madhavarama
467.
MS. Wilson 225° .
i8 33 • • •
Madhavarama
469.
MS. Wilson 225 d .
1833 . . .
Madhavarama
530.
MS. Wilson 91 . .
i8 33
584.
MS. Wilson 45 . .
1833 • • •
Madhavarama
838.
MS. Wilson 535 .
i8 33
191.
MS. Mill 45 . . .
1834 . . .
Sambhunatha
314.
MS. Mill 20 . . .
i8 34
528,
529. MSS. Mill 82,
83
1834 . . .
Bhuvanlramajosi
588.
MS. Wilson 182
1834
39-41. MSS. Mill 139-141
1835 . . .
Madhorama
312.
MS. Wilson 308s .
1835
821.
MS. Mill 145 . .
.
1835
600.
MS. Wilson 278 s .
1847
CATALOGUE OF SANSKRIT MANUSCRIPTS
APPENDIX TO YOL. I
1-13— MSS. Wilson 131-143
Mahabharata, &c., 18th cent.?
Contents: this text of the Mahabharata resembles
fairly closely that given in the Calcutta edition. The
commentary varies very much in fullness, becoming in
some cases merely occasional glosses; cf. Eggeling,
India Office catal., p. 1155.
In 131 , 132 , 1-137 there is no boundary to the
text; in 133 , 138—280 there is one, consisting of three
dark red lines, partially covered by one light one.
Ff. 143, 146, 149, 150, 153, 156, 159, 164, 170, 175,
177, 180, 183, 186, 189, 192, 195, 198, 201, 204, 207,
216, 219, 226, 229, 231, 234, 280 are covered, wholly or
in part, with yellow pigment. On f. 280 the number
of verses is given as 2,711, and there is a table of
contents.
In 133 many leaves are of yellow paper. Boundary
as in 132 . Ff. 219-225 are recently supplied.
In 134 many leaves are of yellow paper. Ff. 35-39,
93-103, 300-311 have been supplied by a later hand.
Boundary as in 132 . List of contents of Yanaparvan
on f. 239.
In 135 many leaves are of yellow paper. F. 139
has been recently supplied. Boundary as before.
In 136 many leaves are of yellow paper. Boundary
as before. Ff. 187-194, 205 have been supplied.
In 137 many leaves are of yellow paper. Boundary
as above.
In 138 two hands are to be traced in the Karna-
parvan. The main hand has written ff. 7—115;
ff. 1-6, 116-157 are supplied by probably the same
hand which has made the corrections in the other vols.
In this parvan the boundary is as before. There is
none in the Sfalyaparvan, and two red lines only in
the Sauptika- and Strl-parvans. Ff. 207, 217-222 have
been supplied by a very recent hand on red paper.
In 139 many leaves are of yellow paper. After
f. 139 twelve sheets of paper have been inserted to
receive the missing matter, but have not been filled up.
In 140 many leaves are of yellow paper.
In 141 ff. 3, 7, 11, 16, 19, 25, 27, 31, 33 are of
yellow paper, with boundary as above. In the rest
two hands must be distinguished, of which one has
written ff. 39—161, 197—263, the other ff. 162—196.
At the end of 142 , f. 349, the number of adhyayas
is given as 146, while it is stated that there are 8,000
slolcas of text, on which 4,000 verses of commentary
are written. The text has no boundary. Ff. 226'",
227 are blank.
In 143 many leaves are of yellow^ paper. There is
no boundary on ff. 1—9, two red lines on ff. 10—53,
three dark red with a light red over them on ff. 54 to
the end, with slight variations.
To decide the number of scribes employed is very
difficult; the following seems to be most probable.
(1) 131, 132, 1-137, 142, by one scribe; (2) 132, 138-
280, 133, 184, 135, 130, 137, 138, 7-115, 139,140,141,
1-38, 142, 54-190, 229-235 ; perhaps also 143, 224-
228, which are of the same date, and give the scribe’s
name, but most unfortunately this is doubtful; (3)
138, 158-203, 143, 1-9; ( 4 ) 138, 1-6, 116-157, 143,
191-223 (not as Bodl. catal., 180-223) 1 ( 5 ) 138 > 2 °4~
2i6 v (middle of leaf), 143, 10-53; (6) 138, 222-242.
There are also a few small additions of various dates.
Probably 141, 39-161, 197-263 fall under (1), and
162-196 are to be attributed to a seventh hand.
On the origin of the Mahabharata see Holtzmann,
Das M., Kiel, 1892-1895; Biihler, Ind. Studies, II,
1892; Jacobi, G'ott. Gelehr. Anz., VIII, 659 sq. ;
Winternitz, J.R.A.S., 1897, pp. 713 sq. Against
Dahlmann’s overestimation of its antiquity, Jacobi’s
view that the epic assumed a form not unlike the
present by the 2nd cent. b. c., is probable enough.
Against Noldeke in Weber, Ind. Lit., p. 187, note 2oi a ,
see Biihler, Manu, p. cxiv; Ind. Ant., XXVII; Vienna
Orient. Journ., XIV, 47 sq. Hopkins, The Great Epic of
India, ch. VI, assigns the epic at the earliest to the 2nd
cent. b. c. and puts all but the very latest parts before
a. d. 200. Cf. Kirste, Zur Mahdbharatafrage, p. 224.
The most probable results are those of Macdonell,
Sanskrit Literature, pp. 282 sq. The theory held by
many Pali scholars and others (Bergaigne, Senart,
Rhys Davids, Grierson, Liiders Die Sage von Rsyasrhga,
BODL. SANS. CATAL. APP.
CATALOGUE OF SANSKRIT MSS.
Gottingische hachrichten , 1897) that the epic is a com¬
paratively late work which borrowed much of its material
from previous akhyanas current in Pali or Prakrit or pre-
Buddhistic vernaculars, ignores the existence of a work
in Sanskrit like the Brhaddevata, not later probably than
the 4th cent, n.c., and the evidence of an early Kavya
literature detailed by Bidder ( Die indischen Inschriften,
1890), besides violating all probability. The itihasas
mentioned in Brfihmanas and Sutras doubtless existed
in a Sanskrit form contemporaneously. The question
of the writing down of the epic (not before 2nd cent.
A.D., if Chinese tradition is correct in assigning the
invention of the r vowel to that period) and of its
present form is quite different.
Cartellieri, Vienna Orient. Journ ., XIII, 57-74, Las
argued that Bana and Subandhu knew the work as an
epic, that Bana knew the Aislkaparvan in a better
form than it now presents, and that Subandhu knew the
work as having 100 parvans (su-parvan). This would
tend to support Holtzmann’s view of the recent date
of much of the work in its present form.
Measurement of binding: 14^ X 7^ in. approximately
for each volume.
No. of leaves:
131 = iv + 294 + iv blank.
132 = iv + 280 + iv blank. In the original foliation
295 - 43 1 + T 43 *
133 = iv + 315 + iv blank. Originally only 314, as
ff. 249-251, which are supplied, correspond to ff. 249,
250 of the original.
134 = iv + 337 + iv blank. Originally foliated 315-
565 (491-501 being passed over)+ 98.
135 = iv +339+ iv blank. The original had only
334 ff., as ff. 153-156 were inserted later, and f. 164 is
repeated.
136 = iv + 318 + iv blank. The original has various
foliations, the best being 46 + 42 + 90-318, the loss of
89 being compensated by the repetition of 270.
137 =iv +271+iv blank. The original foliation
makes 272, but ff. 48, 49 form one leaf.
138 = iv + 242 + iv blank. In the original foliation
137 + 46 + 19 + 20.
139 = ii + 311 +ii blank. Originally foliated 1—139,
1 52 - 244 ) i“ 79 * After 139 are inserted 12 blank leaves.
140 = iv + 258 + iv blank. The original foliation
makes 255, as ff. 53-55 are repeated.
141 = iv + 263 + iv blank. The original foliation is
256-421, as it repeats 300-399 and passes over 308,
361, 362.
142 = ii + 349 + ii blank. The original foliation
makes 347, as ff. 166 and 225 are repeated.
143 = ii + 235 + ii blank. Originally foliated 9 +
44+ IJ 5 (really 116, as 68 is repeated) + 11 + 33+ 5 +7.
Bate: all that is written by scribes 1 and 7, including
141 , 39—161, 397—263, belongs to about the end of
the 18th century. Scribe 3 is probably of the beginning
of the 19th. For scribe 2 the dates are:
(1) 134 , f. 239 : samvat 1793 ( = a.d. 1737) 1
(2) 135 , f. 339 v : samvat 1792 ( = a.d. 1736) mlti
bhddaivavadi pamcaml vdramamgaluke I 1732 in the
Bad!, catal. is a slip.
(3) 136 , f. 318 : samvat 1794 ( = a.d. 1738) mlti
editasudi duijivdramamgala l 1734 in the Bodl. catal. is
wrong.
(4) 137 , f. 271: samvat 1795 (=a.d. 1739) mlti
mdghasuddi I
(5) 139 , f. 232 : samvat 1792 1
( 6 ) 139, f. 331 : 1792 mdghasute rasivdira kuvi-
phai (?) I
(7) 143 , f. 179 : samvat 1794 l
( 8 ) 143, f. 228 '': samvat 1793 dsddhakrsnadvd-
dasydim ravisutadine \
For scribe 4 there are two dates:
( 1 ) 138, f. 157 : samvat 1804 ( = a.d. 1748 ) samai-
ndma jesthavadi 2 vara sanivdra 1
(2) 143 , f. 223 : samvat i8o3'( = a.d. 1747) I
For scribe 5 there arc two dates:
(1) 1*8, f. 2 i6 v : samv 1839 sake 1704 ( = a.d.
1782)1
(2) 143 , f. 53 v : samvata 1839 sake 1704 marge must
krsnapak§e tithau pratipadaydm budhavdsdirdnvitdydm 1
For scribe 6 the date is ( 138 , f. 242): samvat 1839
sake 1704 pause mdse krsnapakse tithau saptumydm
7 guruvdsare 1
Scribe: only three names appear. One (perhaps that
of scribe 2) appears on 143 , f. 228 v : lim° bhisdriddsa 1
That of scribe 5, on 138 , f. 2i6 v : ti °m idam pustakam
Ghanasydmena tripat hind Bhadrapuravasina 1 So on
143 , f. 53V. That of scribe 6 on 138 , f. 242 : likhitam
idam pustakam Suvarna (corrected from °e) -tripdthind
Bhadrapuranivdsina parartham ca \
14, 15— MSS. Mill 131, 132
Mahabharata, &c., 18th and 19th cent.?
Contents : for Arjunamisra’s commentary see Weber,
Catal., I, 104-106, (like no. 395 is the mixing of
Arjuna and S'rldhara’s commentaries), where, however,
the proposed identification of Caturbhuja and Arjuna
is not correct; Eggeling, India Office catal., pp. 1151
(Adiparvan), 1152 (Bhlsmap., with S'ridhara), 1154
(Moksadharma); Mitra, Notices, VI, 192 (Adip.), 219
(Viratap.); Stein, Kasniir catal., p. 196 (Danadharma).
3
APPENDIX TO VOL. I (1-24)
The ascription of the commentaries on the Mahabharata
is not yet cleared up. Arjuna is earlier than Nilakaptha
(16th cent.). Narayapa’s date is about a.d. 1400 at
latest, Biihler, Manu , p. cxxix.
The text is bounded on either side by three red
lines. Very many lacunae are marked.
Probably both volumes were written by the same
hand, though the second volume looks older.
Measurement of binding : 16^ X 9 in. approximately
for each volume.
No. of leaves: 131 = ii + 309 + ii blank; 132 = ii + 311
+ ii blank.
16-18— MSS. Walker 218-220
Mahabharata, Sic., 18th cent. ?
Contents: the MS. is not at all accurate, and marks
a very large number of lacunae.
Even the Harivamsa is earlier than the end of the
5th cent. a. d., Macdonell, Sansk. Lit ., p. 287. It
and the introduction to Books I and XVIII are later
than a. d. 100-200, as they mention dinaras, see Hopkins,
The Great Epic of India, p. 387.
Measurement of binding: 15^X 10J in. approximately
for each volume.
No. of leaves : 218 = iv + 238 + ii blank ; 219 = ii +
236 + iiblank; 220*=ii + 216 +ii blank. The number
of leaves in the original foliation is 144-6 + 14 + 692
(really 656,33 ff. 153-163,178-200,218,219 are missing).
19, 20— MSS. Wilson 144, 145
Harivamsa, &c., 18th cent. P
Contents: the text is placed in the centre of each
page, the commentary at the top and bottom. It is
bounded on either side by two broad red lines over
two or more thin lines. F. 291 has been supplied in
place of the old f. 287.
The Mahabharata was printed at Bombay in 1863 ;
Calcutta, 1882-1894; Bombay, 1890; both Bombay
editions including Nilakantha’s commentary. Trans¬
lated by Protap Chandra Roy, 1886-1896, by M. N.
Dutt, 1895 sq. Cf. Winternitz, On the South Indian
recension of the Mahabharata , Bombay, 1898.
Measurement of binding: 14-I- X 7| in. approximately
for both volumes.
No. of leaves: 144 = iv + 340 + iv blank ; 145 = iv +
351+iv blank. The original foliation numbers 686
leaves consecutively, but ff. 83-103 have been replaced
by ff. 83-108; ff. 26, 484 are repeated ; ff. 128, 253 are
passed over.
Bate : about the end of the 18th century.
21 —MS. Mill 78
S'akuntalopakhyana, 19th cent.?
Contents: the text only occupies the recto of each
leaf, and is neatly, though inaccurately, written.
A translation of the story was published in the
Oriental Repertory, vol. II, by Wilkins, in 1795.
Measurement of binding: ioj X 8 in.
No. of leaves: iii + 41+ix blank. The leaves are
arranged as in a European book.
Injuries: the MS. having become wet, the writing
of the recto shows through on the verso.
22— MS. Mill 112 a
Bhagavadgita, &c., A.D. 1817.
Contents: in this and the other parts of the MS.
the text is bounded on either side and at the top and
bottom by an elaborate margin in red and blue. The
first page of each part is ornamented.
Bound in a native cloth binding, with flap.
Measurement of binding: 3^ X 5- in.
No. of leaves: x+ 559+ix blank. The fourteen
parts in the original foliation have 146+107 (4 pieces)
+ 22 + 20 + 28 + 38 + 40 + 27 + 33 "h 28 + 1 o + 9 + 4 + 8
leaves. Arranged like a European book.
Bate: f. 559 : samvat 1873 (3 is doubtful = a.d. 1817)
bhasruti trtiyasyam ravau \ This applies to the whole
MS.
Scribe: f. 559 : likhitam Kasmiramadhye Ilafha-
pamdita bhabhuramaki pathandrthi Vaisnavakausalyu-
dasavidyarthi subham I
Character: Devanagarl, with some Kasmirl features.
23— MS. Mill lll a
Bhagavadgita, Sic., 19th cent.?
Contents: the text is surrounded with an elaborate
border of blue and red lines. Pictures of Krsna on
ff. 10, 79. -
Measurement of binding : 4 x 6 J in.
No. of leaves : iii + 229+v blank. The five parts
in the original foliation have 125+30 + 21 + 10 + 28
leaves. Arranged like a European book.
24— MS. Wilson 256
Gitabhasya, A.D. 1821.
Contents: Telang, Ind. Ant., XIII, 95 sq., dates
S'ankara about a.d. 590; Fleet, ibid., XVI, 42, bn the
b 2
4
CATALOGUE OF SANSKRIT MSS.
ground of a legendary visit to Vrsadeva of Nepal,
shifts the date to a.d. 630 ; Bhandarkar, Report , 1882,
1883, p. 15, from the Samksepasariraka, about a.d. 680
or end of 6th cent. Yajnesvar, Aryavidydsudhdkara,
p. 226, on the authority of a sampradaya in S'rngeri,
assigns his birth to a. d: 788. So Logan, Ind. Ant.,
XVI, 161, from a Malayfdam tradition. Finally
Iv. B. Pathak has shown (a) that one MS. gives this
date, Ind. Ant., XI, 174; (Z») that Sankara quotes
a verse of Dharmaldrti, whom I-tsing and Taranatha
assign to the 7th cent., Journal Bombay Br. R. A. S.,
XVIII, 88-96; (c) that he quotes Kumarila who
([notes the Vakyapadlya of Bhartrhari, ibid., 213 sq.
The traditional date is thus confirmed, cf. Biihler,
Ind. Ant., XIV, 14, Manu, p. cxii; Max Muller, India,
p. 360.
Printed at Poona, 1886 sq. Cf. Aufrecht, Leipzig
catal., p. 32. .
Measurement of binding : n~X in.
Material: 4 S. Wise & Co.’ is water-marked on the
paper.
No. of leaves: ii + 126 4- ii blank.
Bate; in or after 1821, the year given in the water¬
mark.
25— MS. Walker 167
Subodhim, A.D. 1798.
Contents: the text is placed in the centre, the
commentary at the top and bottom of each page.
This is the longer recension of Srldharasvamin’s
Subodhini, from which the ordinary text is derived,
Aufrecht, Leipzig catal., p. 32.
Measurement of binding: 11| X 8-| in.
No. of leaves : iii + 103 4- ii blank.
Bate : f. 103 : samvat 1854 varse sake 1720 ( = a. d.
1798) pravarttamane raviuttardyanegrlsmartau mdsotta-
inuindse madhukrsnapakse dasamydni tithau guruvdsare 1
Scribe : f. 103 : adyeha Madavivlmdaramadhye vdsta-
vyam l visalanagarandgarajndtiyamemtdsrl 5 venlramma
tasya putra memtasri 5 kuberajl tasya pathanarthe
Upikrtd 1 Girmdrdyanajndthyajosikevalardmmena likhitd \
Cf. no. 31 .
Character: Devanagarl, with some Jaina charac¬
teristics.
26— MS. Mill 112C
Bhlsmastavaraja, A.D. 1817.
Contents : cf. Aufrecht, Leipzig catal., p. 34. Santi-
parvan, eh. 47. ____
Measurement, %c. : this is part 2 (ff. 37-60) of the
MS. described under 22.
27— MS. Mill lll c
Bhlsmastavaraja, 10th cent.?
Contents : text arranged as in 23 . Picture on f. 161.
Measurement, fyc.: this is part 3 of the MS. described
under 23 .
28— MS. Mill 112b
Visnusahasranamakathana, A.D. 1817.
Contents : repeatedly printed in India, e. g. at Delhi,
1876; Poona, 1877. See Aufrecht, Leipzig catal.,
p. 35. Anusasanikaparvan, 13, 149.
Measurement, fyc.: this is part 2 (ff. 1-36) of the
MS. described under 22.
29— MS. MiU 111b
Visnusahasranamakathana, 19th cent.?
Contents : text arranged as in 23 . Picture on f. 130.
Measurement, fyc.: this is part 2 of the MS. described
under 23 .
30— MS. Walker 179 b
Visnusahasranama, A.D. 1782.
Contents: the text is bounded on either side by
two dull red lines. Cf. MSS. Sansk. c‘. 56 ( 1223 ),
d. 63 (1222); Hall, Bibl. Index, p.127; Eggeling, India
Office catal., p. 1.171, mentions an edition, Benares,
1868 (?); Aufrecht, Leipzig catal., p. 35 ; Garbe,
Tubingen catal., p. 29; Bendall, Brit. Mus. catal.,
PP- 5 *> 53 - -
Measurement, fyc.: this is part 2 of the MS. described
under 169 .
Date: f. g 6 x : samvat 1838 ( = a. d. 1782) nd srdva-
nasudi 7 bhrgau likhitatn \
Scribe: f. 96 v : agnihotrivydsatulasisutabhudevand-
mnd likhitam I
Character: Devanagarl, with some Jaina charac¬
teristics.
31— MS. Walker 202
Afivamedhikaparvan, A.D. 1791.
Contents: this parvan was printed at Bombay in
1882, and elsewhere. Cf. Weber, Monatsber. der Bert.
Acad., 1869, pp. 10 sq.; Bendall, Brit. Mus. catal., p. 27.
The text is bounded on either side by three red lines.
Measurement of binding: ioi x 7j in.
APPENDIX TO VOL. I (24-41)
No. of leaves: ii + 220+ ii blank. In the original
foliation there are 221 leaves, f. 65 being passed over.
Bate: f. 220: samvat 1847 ( = a.d. 1791) na varse
phdlgunamase krsnapakse dvitiyayam tithau somavasa-
rena \
Scribe: the patron is given on f. 220: lakhavitam
metasri 5 veniramasutaputrena Kuberajicaranajivi l
See no. 25.
Character: Devanagari, with some Jaina charac¬
teristics.
32 — MS. Wilson 100
Aivamedhikaparvan, A. D. 1809.
Contents: the text is bounded on either side by two
red lines.
Measurement of binding: 13^ x 6-| in.
No. of leaves: ii +153 + ii blank. The original
foliation passed from 89 to 100; this is corrected, but
the new numbering has only 152 ff., repeating f. 128.
Date: f. 153: mdsottamama.se maghamase vasamtartau
punyatitliau mamdavasare 5 samvat 1865 ( = a. d. 1809) I
33 — MS. Mill 112*
Vaisnavi Anusmriti, A. D. 1817.
Contents: it consists of seventy-four verses, and is
said to be derived from the Visnudharmottara section
of the Mahabharata. It is not in that work. Cf.
Aufrecht, Flor. catal., p. 4, Leipzig catal., p. 38;
Eggeling, India Office catal., p. 1159. Often printed
in India as part of the Pancaratna.
Measurement , <8fc. .• this is part 2 (ff. 61-74) of the
MS. described under 22.
34 — MS. Mill llll
Vaisnavi Anusmriti, 19th cent.?
Contents: text arranged as in 23 . Picture on f. 184.
Measurement, fyc.: this is part 4 of the MS. described
under 23 .
35 — MS. Mill 112©
Gajendramoksana, A.D. 1817.
Contents: this work, like 33 , is not in the Maha¬
bharata, but forms a part of the Pancaratna. Cf.
Wilson, Mackenzie catal. 2 , p. 127. A similar narrative
occurs t in the Bhagavata Purana, Holtzmann, Zur
Gesch. d. Mahabharata, IV, 45. Cf. Aufrecht, Leipzig
catal., p. 34. _
Measurement, %c.: this is part 2 (ff. 75-107) of the
MS. described under 22.
36 — MS. MiU 111®
Gajendramoksana, 19th cent. P
Contents : text arranged as in 23 . Picture on f. 200.
Measurement, fyc.: this is part 5 of the MS. described
under 23 .
37 — MS. Walker 201*
Balabharata, 19th cent.?
Contents: edited in Pandit, vol. IV, sqq., old series,
and in Kdvyamdld, no. 45 . Cf. Mitra, Bikaner catal.,
p. 229.
The text is bounded on either side by two black
lines. It is very inaccurate.
Amaracandra was a pupil of Jinadatta of the Vaya-
dagaccha, about the middle of the 13th century,
Bhandarkar, Report, 1883, 1884, p. 6, not nth cent.,
as stated in the Z.D.M.G., XXVII, 170. Cf. bhumika
to Kdvyamdld edition.
Measurement, §c.: this is part 2 of the MS. described
under 610 .
Date: beginning of 19th century.
38 — MS. Walker 132«
Partha Itihasasamuccaya, A.D. 1774.
Contents: see Weber, Catal., I, t 18 ; Garbe, Tubingen
catal., p. 32; Mitra, Notices, I, 83 ; Eggeling, India
Office catal., p. 1178 ; Aufrecht, Leipzig catal., p. 41.
The text is bounded on either side by three red lines.
Measurement of binding : 1 o X 6 ^ in.
No. of leaves : ii + 190 + ii blank. The four parts
have 12 + 18 + 73 + 87 leaves.
Date: f. 103: samvat 1830 (=a.d. 1774) pausavadi
2 gurau likhitam I
Scribe: f. 103: agnihotrivydsatulasi tasyatmajabhu-
devanamna vilikhitam asti I
Character: Devanagari, with some Jaina charac¬
teristics.
39 - 41 — MSS. Mill 139-141
Ramayana, A.D. 1835.
Contents: edited in full, by Parab, Bombay, 1888;
at the Srikalpataru press, Bombay, 1889; in Grantha
characters, Madras, 1889 (many differences of reading).
Translated, Calcutta, 1891-1894 (M. N. Dutt editor),
and into verse by Griffiths, new edition, Benares, 1895.
On its contents and criticism see especially Jacobi, Das
Ramayana, Bonn, 1893, Z.D.M.G., XLVIII, 407 sq.,
G CATALOGUE OF
LT, 605 sq.; Ludwig, Ueber das R., Prag, 1894;
Baumgartner, Das R., Freiburg i. B, 1894; Hopkins,
Epic of India, ch. II; Liiders, Gottingische Nachrichten,
1897 ; Macdonell, Sansk. Lit., pp. 304 sq.
130 seems to be written by another hand than 140
and 141. There are several lacunae. The scribe adds
a verse or two on Sravanavidhi.
Measurement of binding: 16} x 5- in. approximately
for each volume.
Material: yellow country paper.
No. of leaves :
139 = ii + 195 + i blank. Original foliation 67 +
128.
140 = i + 17 6 + i blank. Original foliation 54 +
56 + 66.
141 = i + 212 + i blank. Original foliation 826 +
86 .
Date: 141, f. 2io v : saptavdnddribhusake a?ddhasya
sitetare 1 pratipadguruvdre ca 1
Scribe: 141, f. 2io v : Madhordmena likhyate 11
42—MS. Wilson 129
Agni Purana, A. D. 1821.
Contents: see Mitra, Notices, I, 97, Bikaner catal.,
pp. 183 sq.; Burnell, Tanjore catal., p. 187. Printed,
Bibl. Ind., 1870-1879, and Calcutta, 1891. ‘Late and
unimportant/ Holtzmann, Mahdbhdrata, IY, 34.
The division of the MS. between the two hands is
as follows : the first hand wrote ff. 6-11, 14, 15, 20, 21,
26, 27, 40-45, 55-60, 67, 68, 71, 72, 75-118,123, 124,
127-130, 139-141, i5 I-I 54> 161, 162, 167-170, 173,
174, 186, 187, 218-221, 224-229, 232-245, 248—251,
254-267, 270-275, 280-301, 359-364, 367-370, 451- I
457> 461, 462, 464, 465, 475-478, 482, 483 ; the other
wrote the rest. The former hand is more neat and
accurate, and numbers the verses, while the latter is
careless. There are some notes and corrections in
Wilson’s handwriting.
Measurement of binding : 13-7X7 in.
JSo.of leaves: ii + 512 + ii blank. The original foliation
counts only 507 ff., as ff. 54, 175, 214, 291, 292 are
repeated.
Date: f.512: samvata 1877 ( = a.d. 1821) 1
43 —MS. Wilson 102
Kurma Purana, A.D. 1748.
Contents: see Eggeling, 7w</ia Office catal., p. 1158;
Mitra, Notices, III, 273-283; edited by Nilmani
SANSKRIT MSS.
Mukhopadhyaya, Bibl. Ind., 1886—1890. Books XII
and XIII of the Mahabharata seem to be used in the
gltas, Holtzmann, Mahdbhdrata, IV, p. 55.
The text is bounded on either side by three or four
red lines. F. 209 has an ornamental tailpiece.
Measurement of binding : 13^ X 6^ in.
No. of leaves : ii + 209+ ii blank. Originally 210,
but f. 116 is lost.
Date: f. 209: samvat 1805 sake 1670 ( = a.d. 1748)
jyestakrsnapakse tithau amdvdsydydm 1
Scribe: f. 209 : likhitam Lalhakatdre 1 Rdthapuma-
dliye l
44—MS. Walker 153
Kurina Purana, 17th and 18th cent. P
Contents: besides the main hand (ff. 5-153), three
others may be distinguished: (1) ff. 2-4, 154-196;
(2) f. 1; (3) ff. 109, 197—227. In the main part the
text is bounded on either side by two red lines.
Measurement of binding: ic^- X 67- in.
No.of leaves: ii + 227 (not 176) + ii blank. Originally
226, because ff. 1-4 replace ff. 1-3 of the old MS.
45— MS. Wilson 352
Kurina Purana, 17th cent.?
Measurement of binding: 12-| X 5j in.
No. of leaves: ii +118 +ii blank. The MS. originally
had 236 leaves and many more.
Date: perhaps about a.d. 1650.
46— MS. Walker 157 a
Garuda Purana, 18th cent.?
Contents: the text is bounded on either side by two
double red lines.
This is a recast of the Pretakalpa, for which see
Eggeling, India Office catal., p. 1201, and the Uttara-
khanda of Rasika Mohana’s edition of the Garuda
Punina, Calcutta, 1885. Cf. Aufrecht, Leipzig catal.,
pp. 44, 45; MS. Sansk. c. 50 (1168).
Measurement of binding: 1 1-7 x 6j in.
No. of leaves : ii + 212 + ii blank.
47 —MS. Wilson 127 b
Brhannaradiya Purana, A.D. 1749.
Contents: for this part see Eggeling, India Office
catal., p. 1208; Weber, Leipzig catal., no. 542 (not
p. 452); Wilson, Mackenzie catal. 2 , p. 120; Mitra,
Notices, I, 291-293, III, 6-8. From the titles of the
APPENDIX TO VOL. I (39-57)
7
chapters this would seem to be a part of the Naradlya
Purana, see Mitra, Notices, IV, 255 sq., where cc. 1-
4i = cc. 1-38 here. Cf. Bikaner catal., pp. 206, 207.
This Purana would then be the mahapurana which has
traditionally 25,000 verses (Mitra gives 2,148 for a MS.
of 808 ff., 13-f- x 6, ten lines, which is impossible), which
would suit very well the 125 + 82 chapters of which it
consists. Probably the pieces, Yadavagirimahatmya,
Visnu°y Srimusna 0 , enumerated in Burnell, Tanjore
catal., p. i88 a , belong as he says to the Naradopapurana,
no. 140 infra. The Visnu 0 however corresponds to
cc. 37—40 of this work. There seems to be no good
reason for calling the Brhannaradiya an upapurana.
Like all the other mahapuranas it has of course come
down to us worked over.
The text is bounded on either side by two red lines.
Nearly one-eighth of the leaves are coloured yellow.
There is a blank circle on f. 196.
Measurement, fyc.: this is part 2 of the MS. described
under 102.
Bate: f. 196: samvat 1805 (=a.d. 1749) marga-
slrsasudha 7 I
Scribe: f. 196: likhitam Khamdenyaphulamvarlpha-
rena \
48— MS. Wilson 104a
Brhannaradiya Purana, 19th cent. P
Contents: the text is bounded on either side by
a broad red line over two double red lines. On f. 123
a lacuna is marked. ___ — __
Measurement of binding : X jj in.
No. of leaves: ii + 202 + ii blank. The two parts
have 123 + 79 leaves.
Scribe: part 1 is by a different, somewhat later, hand
than part 2 ( 128 ).
49 — MS. Wilson 110 a
Brhannaradiya Purana, 19th cent.?
Contents: the MS. is on yellow paper of country
make.
Measurement of binding: 16-| X 6-j in.
No. of leaves: ii + 179+ii blank. Originally two
MSS. containing 84 + 93 leaves.
Scribe: both parts are by the same hand.
50 - 55 — MSS. Wilson 116, 113, 114, 112, 111, 110
Padma Purana, 18th cent. P
Contents: see Eggeling,/nrfiaO#?ceca£a/.,pp. 1215 sq.;
Mitra, Notices, II, 1, III, 247 sq.; Weber, Catal., II, 133;
MS. Sansk. c. 53 (1170). V. N. Mandlik has edited it,
Anandasrama Series, 1893-1894. The edition differs
much from this text, which perhaps represents a Bengali
recension. Liiders, who has edited the episode of
Rsyasrhga, gives reasons ,Gottingische Nachrichten, 1897,
p. 94, note 2, for regarding this as the older version.
The text is neatly arranged throughout in three rows.
On the relation of this Purana to the Mahabharata
see Holtzmann, Mahabharata, IV, 33 sq.; Liiders,
Gottingische Nachrichten, 1897, p. 101, argues pretty
conclusively that the version of that legend contained
in it is older than the Mahabharata version. Cf.
Macdonell’s remarks, Sansk. Lit., p. 299, and on the
dates of the Puranas, see Haraprasada, Report, 1891—
1895, pp. 2-4. -
Measurement of binding : 1x 6J in.
No. of leaves:
115 = ii + 233 + ii blank.
113 =ii + 209 + ii blank.
114=ii + 114 + ii blank.
112=ii + 158+ii blank. The original foliation
makes 260 ff., as ff. 1, 31 are passed over.
111=ii +352+ ii blank. The original foliation
makes only 350 ff., as a mistake has been made after
f. 90, and though ff. 91-139 have been corrected, ff. 138,
&c. represent ff. 140, &c.
116 = ii + 118 + ii blank.
56 —MS. MiU 4
Kriyayogas§ra, A. D. 1741 .
Contents: the MS. is written partly on red, partly
on white paper. It has been corrected occasionally
by a later hand.
Cf. Eggeling, India Office catal., p. 1224; Weber,
Catal., I, 131 ; Mitra, Notices, III, 113 sq.
Measurement of binding: i6f X 4-I in.
No. of leaves: i + 119 (in the original foliation 4 un¬
numbered + 115) + i blank.
Bate : f. 119: sakabddh 1663 (=a. d. 1741) l
57 ~ MS. Walker 166 a
Maghamahatmya, A. D. 1771.
Contents: this section was printed at Bombay in 1861
(25 chaps.) and 1879; at Madras in 1868 (37 chaps.); see
Eggeling, India Office catal., p.1221; Aufrecht, Leipzig
catal, p. 53 (37 chaps.). Cf. MS. Sansk. d. 61 ( 1188 ).
The text is bounded on either side by. three red lines.
Measurement of binding: 1 ij x 7^ in.
No. of leaves: ii + 132+ii blank. In the original
foliation the three parts have 52+38 + 41 leaves.
8
CATALOGUE OF
Date: f. 52 v : samvata 1827 ( = a.d. 1771) nd varase
mdghasuda 2 bhrgau I
Scribe: f. 52 v : pathanartham Vydsasrl 5 bhudeva \
Usual style of Bhudeva’s MSS.
58— MS. Walker 208 a
Maghamahatmya, A. D. 1708.
Contents: the text is bounded on either side by two
double yellow lines. ___
Measurement of binding: io| X 6^ in.
No. of leaves: this is part 1 of MS. Walker 206
which has ii + 165 + ii blank leaves. The original parts
have 61+ 17+ 14 + 6+6+17+38 leaves.
Date : f. 6i v : samvat 1765 varse sake 1630 ( = a. n.
1708) pravarttamdne daksinasthe srlsurye pausasudi 15
gurau likhitam \
59— MS. Walker 166b
Karttikamahatmya, A.D. 1770.
Contents: printed with a Brijbhasa commentary,
Delhi, 1877. Cf. Aufrecht, Leipzig catal ., p. 47.
The text is bounded on either side by three red lines.
Measurement, §c. : this is part 2 of the MS. described
under 67 .
Date : f. 90: samvat 1826 ( = a. d. 1770) nd varse
asuvadi 9 bhaume l
Scribe : f. 90: pathandrthain Vydsasrl 5 tulasisuta-
Ihudeva l Cf. no. 57 . Usual style.
60— MS. Mill 77 c
Prayagamahatmya, 19th cent.?
Contents : this work in Eggeling’s MS., India Office
catal., p. 1219, has 100 chapters. Printed at Benares
in 1867.
The text is bounded on either side by two double
red lines. _____
Measurement, fyc. : this is part 3 of the MS. described
under 722 .
61— MS. Mill 110
S'ivaglta, A. D. 1749.
Contents : its ascription to the Padma Purana is
confirmed by the fact that it frequently occurs else¬
where, Eggeling, India Office catal., p. 1225 ; Aufrecht,
Leipzig catal., p. 55; Burnell, Tanjorq catal., p. 189**4
Winternitz, B.A.S. catal., p. 37; Mitra, Notices, V, 95 ;
but ibid., IV, 84, it is attributed to the Matsya. Printed
at Bombay in 1856.
SANSKRIT MSS.
The text is bounded on either side by two yellow
lines. F. 5 V is blank.
Measurement of binding: 5^ x 4^ in.
No. of leaves: i 4-116 + i blank. The original foliation
makes 117, but there is no f. 33. Arranged like a
European book.
Date: f. 116: samvat 1805 (=a.d. 1749) bhddrapa -
damdse suklapaksasaptame guruvdsare sampurncm 1
Scribe: f. 116: iti srlmadhusudandnamdaprasddena
S'isaharihardnamda likhak pathyak subham astu 1
62— MS. Wilson 126
Brahma Purana, A.D. 1828.
Contents : this is called in the colophons Adipurana.
See Eggeling, India Office catal., p. 1231 ; Mitra,
Notices, III, 149, Bikaner catal., pp. 187-189; Holtz-
mann, /. c., p. 32. Published in the Ananddsrama
Series, 1895. The chapters are not numbered, and
the MS. is very inaccurate. Many lacunae are marked.
The text is bounded on either side by three red lines.
Measurement of binding : 14^ x 8^- in.
No. of leaves : iv 4- 201 4 - iv blank. The original
foliation makes 206, but there are no tf. 174-177, 189.
Date: f. 201: samvat 1882 (=a.d. 1826) 1
63— MS. Wilson 366
Brahma Purana, A.D. 1772.
Contents: the text is bounded on either side by
two red lines. It is fairly accurate on the whole.
Some corrections have been made by a later hand.
Measurement of binding: lOj X 7 in.
No. of leaves: ii4-178 4-ii blank. The original
foliation makes 181 leaves, ff. 20—22 being lost.
Date: on f. 1 is written : samvat 1828 (= a. d. 1772),
but this may merely be some owner’s date. The MS.
looks somewhat older.
64— MS. Wilson 354
Brahma Purana, 17th and 18th cent. P
Contents: this MS. seems to consist of two parts,
an older MS., and a newer which was written to
fill up the lost portions of the other. To the first
belong ff. 1-9; to yet another hand ff. 76-79, 82-
85, and what is now f. y^, whose original number
was apparently 78 (not 86 as in the Bodl. catal.).
All the rest is later. F. 75b claims to contain the end
of adhyaya 30. Adhyiiya 29 ends on f. 84 v . Really
APPENDIX TO VOL. I (57-73)
!)
f. 75 b contains the end of adhyaya 28. The verso is
blank, verses 1—15 of adhyaya 29 thus being lost.
Of adhyaya 30 only twenty-six verses are left. The new
part is bounded on either side by two red lines.
* Measurement of binding : nfx6fin.
No. of leaves: i + 85 (really 86, as f. 7.5 is double) + i
blank. The original foliation makes 88 leaves, but
ff. t 2,13, 79 are missing.
Date: the oldest part is perhaps of the end of the
17th century, the rest of the middle of the 18th.
65, 66 —MSS. Wilson 98, 99
Brahmavaivarta Purana, 10th cent. ?
Contents: see Wilson, Works, III, 91 sq.; Eggeling,
India Office catal, pp. 1236 sq.; Mitra, Notices , III,
227 sq.; Burnell, Tanjore catal., p. 187^, says truly
that it is more Tantra than anything else. Edited
by Mathuranatha Tarkaratna, Calcutta, 1881—1890.
Cf. Holtzmann, Mahabhdrata , IV, 34-36; Aufrecht,
Leipzig catal., pp. 59, 60.
The text is bounded on either side by a broad red
line over three narrow ones.
Measurement of binding : 13-7 x 8f in. approximately
for both volumes.
No. of leaves :
98 = ii +342 +ii blank. Originally foliated 67
(really 68, f.67 being repeated) +177 + 96 (f.41 repeated,
really 97) leaves. After f. 308 an unnumbered leaf
is inserted, containing, in Aufrecht’s hand, two verses
omitted in the text.
00 = ii + 399 + ii blank.
67, 68— MSS. Walker 163, 164
Brahmavaivarta Purana, 18th cent. ?
Contents : perhaps two hands may be distinguished: ,
the first, 163, ff. 1-79, 164, ff. 88-206; the second, I
163, ff. 80-211, 164, ff. 1-87. There are frequent
lacunae throughout. •
Measurement of binding : 1 if X 6f in.
No. of leaves : 163 = ii +21J+ii blank ; 164 = ii +
2c6 + ii blank. Originally in three parts: ff. 1-79;
ff. 1-219 ; ff. 1-119.
69— MS. MiU 18
Prakrtikhanda, 18th cent.?
Contents: from f. 138 onwards the text is usually
arranged in three rows, one below the other.
Measurement of binding: 15x4-7 in.
BODL. SANS. CATAL. AI*P.
Material: the paper is yellow or dark grey in
colour.
No. of leaves: i + 169 + i blank.
70— MS. Wilson 245 c
Kasimahatmya, 19th cent.?
Contents: see Eggeling, India Office catal., p. 1237 ;
Burnell, Tanjore catal., p. 189 (°kaivarta being, as
Eggeling says, a misspelling of c vaivarta); printed as
Ivaslrahasya, Benares, 1865.
Measurement, Sfc. : this is part 3 of the MS. described
under 210.
71— MS. MiU 42*
Pancakrosamahatmya, A. D. 1812?
Contents : adhyaya 1, 72 verses, ends on f. 6; 2
(or 9), 136 verses, ends on f. 15 ; 3 (or 10), 87 verses,
ends on f. 19; 4 (or 11), 61 verses, ends on f. 22.
See Mitra, Notices, X, 291, 292.
The text is bounded on either side by two double
black lines.
Measurement of binding : 13I-X6I in.
No. of leaves: ii + no+ii blank. As originally
foliated the four parts have 22 + 23+57+8 leaves.
Date: f. 22: samvat 1868 ( = a.d. 1812) mdrgasisa-
suklapakse saptamydm mamdavdsare I
Scribe: f. 22: likhitam Go° hanumdnagiri svahaste
svagrhe l
72— MS. MU1 51
Adhyatmaramayana, 19th cent.?
Contents: often printed, e.g. at Bombay in 1884.
Written by a Slvaite according to Aufrecht, Leipzig
ratal., p. 61.
Measurement of binding : 12j X 6-7 in.
No. of leaves : i + 148 +i blank. Originally foliated
41 + 107.
73—MS. Wilson 105
Adhyatmaramayana, A. D. 1801.
Contents: the seven kandas end on ff. 22 v , 56 v , 82,
no, I27 v , i8i v , 223. Sarga 5 of kanda 7, with the
commentary, is written in an*older hand than the rest.
Ff. 1—56 are bounded on either side by two double
yellow lines.
Often printed, e.g. at Bombay in 1857. For the com¬
mentary cf. Mitra, Notices, VIII, 215; Eggeling, India
Office catal., p. 1242. Ilamavarman Yuvaraja, sister’s
10
CATALOGUE OF
son of King lliimavarman, lived from a. d. i 755“ 1 7 8 7^
Kavyamdld 40, Aufrecht, Catalogus Catalogorum , II,
121, and as Nagesa was Ramavarman’s guru, he must
have flourished about a. d. 173°* Ramavarman’s father
was Ilimmativarman, Aufrecht, Leipzig catul., p. 62.
Measurement of binding : 13^ x 6-j in.
No. of leaves : ii + 223 + ii blank. Originally each
kanda was foliated separately, having 22 + 34 + 26 + 28
+ 17 + 54 + 42 leaves.
Date : f. 208: samvat 1857 17 (=a. d. 1801 appar¬
ently, but what is the 17 ?) I This, however, only applies
to If. i95 v -2o8, and the rest must be somewhat later.
Only the month, &c., are given on f. 223: caitravadi
sudi pamcami ravivusare krtikdnaksatre prltindmayoge
sdyamveldyam \
Scribe: that of all but ff. I95 v -2o 8 is named on
f. 223 : likliitam Matiramavidyarathi (?) (date as above)
samdpte manikarnikdydm samipe vrahmandlehanumata-
e. aurdydm amtare Mahadevapdtfiakaki havolaume gram-
thasamkhyd 5311 l
74— MS. Walker 130
Adhyatmaramayana, A. D. 1792.
Contents: for a list of the parts of this Purana see
Aufrecht, Catalogus Catalogorum , p. 387, II, 87, 88.
Measurement of binding : 10-5- X in.
No. of leaves : ii + 205 + ii blank. In the original
foliation 204, as ff. 93, 165 are double, and there is no
f. 99.
Date: f. 205 v : savata 1848 ( = a.d. 1792) nd v.arse
jyestavida 12 some I
Scribe : f. 205 v : likliitam josisomaji ddmaji (?) I
75— MS. Wilson 103
Bhavisya Purana, 18th cent.?
Contents : a Bhavisyat Purana is cited in Apastamba
Dharma Sutra, see Hopkins, Epic of India , pp. 6, 48.
For Colebrooke’s MS. see Eggeling, India Office catal.,
p. 1254. Mitra, Notices, VIII, 5, enumerates 133
adhyayas. The end of the Purana as given in Mitra
agrees with this MS. Edited at Calcutta in 1886. The
Purana is later than Manu (before a. d. 200), and
earlier than the Matsya, which is before a. d. 1000,
Biihler, Manu, p. cxi. Cf. Aufrecht, Catalogus Catalo¬
gorum, p. 800.
The text is bounded on either side by four red lines,
with a broad line over them.
SANSKRIT MSS.
Three hands must be distinguished: (1) ff. 1-32;
(2) ff. 33- 8 5; (3) ff - 86—127.
Measurement of binding : 12^x7^ in.
No. of leaves : ii + 127 + ii blank.
76— MS. Wilson 120
Bhavisyottara Purana, 18th cent. ?
Contents: the text is bounded on either side by
two double red lines. The MS. is inaccurate.
Measurement of binding : 147 x 6 f in.
No. of leaves: iii + 218+ ii blank. The MS. has
three several native foliations, the best of which gives
a total of 216.
77— MS. Wilson 124
Bhavisya Purana, A. D. 1826.
Contents : the text is bounded on either side by
two or three broad red lines. Lacunae are frequent.
F. 1 contains a rather elaborate head-piece.
Measurement of binding: 14-7X9 in.
No. of leaves: ii + 367 + ii blank. Originally foliated
as two parts with 141 (really 142, as f. 15 is repeated)
+ 225 leaves.
Date :
(1) at end of part .1, f. 142: sammvat 1882
( = a.d. 1826) miti sdvanasddi l 15 I sanicara 1
(2) at end of part 2, f. 367 : samvat 1882 bluidau
sudi 5 l
78—MS. Walker 129 h
Ganesastavaraja, 18th cent. ?
Contents: the MS. is written in the same style as
243, 730, the centre usually containing one large round
spot.
Measurement, fyc.: this is part 9 of the MS. described
under 98.
Scribe : by the same hand as 243, 730, and perhaps
729.
Character: Jaina Devanagarl.
79-81—MSS. Wilson 121-123
Bh&gavata Purana, &c., A. D. 1813-1816.
Contents: on the relation of the Purana to the
Ramayana cf. Liiders, Die Sage von Rsyasriiga, p. 109,
note 2. The commentary has been printed in the
Bombay editions, i860, 1876,1882, 1887, and at Luck-
APPENDIX TO VOL. I (73-87)
11
now, 1866-1870, and the Nirnaya Sagara press, 1894.
The hands of four different scribes can be traced. To
the first belongs 121, ffi 1—123, 243—408 ; 122, fF. 1-219 ;
123, fF. 268-460. The text is bounded on either side
by two broad red lines, and the paper is frequently
yellow. To the second belongs 121, fF. 124—242. To
the third belongs 122, fF. 317-424. To the fourth
must be referred 122, fF. 220-316, and all the rest of
123. Occasionally yellow pages occur in this part.
The text is in all cases arranged in the centre of
each page, the commentary being at the top and bottom.
Measurement of binding: 14^x7^ in. approximately
for each volume.
No. of leaves:
121 = ii-h408 H-ii blank. There was originally a
separate foliation for each book, 81+42+118 + 166
leaves, a blank leaf being inserted after f. 123.
122 = ii + 424 + ii blank. Originally 124 (really
119, as fF. 1—6 are missing, and a blank f. 4 is inserted) +
100 + 99 (really 97, as fF. 1,2 are missing) + 58 + 50 leaves.
123 = ii + 508 + ii blank. Originally 146 (really
145, as fF. 71, 72 are missing, and f. 132 has split) +
122 + 193 + 53 leaves (really 48, as fF. 1-8 are missing).
Date :
(1) 121 , f. 81: samvat 1871 ( = a. d. 1815) adhika-
bhadre mdsi paurnamasyam 1
(2) 121, f. 408 : sainvat 1871 sravane mdsi Sukla-
caturdasyam ravivasare \
(3) 122, f. 119 V : sainvat 1869 (= a. d. 1813) mdrga-
sirse mdsi krsne 14 i
These dates apply to the first hand. The second
hand may be dated about a. d. 1840—1850. The third
hand probably about a.d. 1820.
(4) 122 , f- 316: jyethamdse suklapakse tithau 8
guruvdsare savat 1872 ( = a. d. 1816) kasydrdjmt 0 \
(5) 123, f. 145 : 1872 sam \
(6) 123, f. 267 : 1872 ka 30 budlie l
These notices apply to the fourth hand.
Scribe : only the name of the fourth is given:
(1) 123, f. 145: li° Vanivamdena Kasyarn \
(2) 123, f. 267 : li° Vanivamdopadhyayena Kasyam
Ilka girimathe 1
82-85— MSS. Mill 133-130
Bhagavata Purana, A.D. 1823.
Contents: the great bulk of the four volumes has
been written by one hand. To two other hands must
be attributed 136, fF. 1-57, and 136, fF. 288-402. A few
pages here and there, e. g. 136, fF. 254, 401, 420-424,
have been supplied by yet more recent scribes.
The text is usually bounded on either side by two
double or single red lines, but frequently these are
omitted. The commentary fills the top and bottom
of each page ; the text is in the centre.
Measurement of binding : 16j- x in.
No. of leaves:
133 = ii + 231 + ii blank. Originally 79 + 39 (really
40, as f. 18 is repeated) +118 leaves (really 112, as
fF. 47-53 are one leaf).
134 = ii + 266 + iii blank. Originally 109 + 93 (really
95, as fF. 29, 67 are repeated)+ 62 leaves.
135 = ii + 171+ii blank. Originally 57 + 61+52
leaves (really 53, as f. 34 is repeated).
136 = ii + 442 + ii blank. Originally 144 + 143 +
114 (f. 1 is lost, but f. 85 is repeated, and in the new
numbering there is no f. 290)+ 40 leaves.
Date:
(1) 133, f. 119 : samvat 1879 ( = A * D - 1823) miti
jestasudi 13 l
(2) 136, f. 118 : srisamvata 1879 sana 1229 kuyd-
rasudhl 4 1 The ‘ sana * date enables us to fix the
year as a. d. 1822, see Sewell and Diksit, Indian
Calendar, p. xcvi.
These two dates refer to the main hand.
(3) 135, f. 57 : miti jethasudi 3 vakhohaphai samvat
18791
86—MS. Wilson 22
Bhagavata Purana, A. D. 1711.
Contents : fF. 315—346 seem not to have been written
by the same hand as the rest. In fF. 1-314 the text
is usually bounded on either side by two red lines.
Measurement of binding : 18-5- X in.
No. of leaves: ii + 346 + ii blank. Originally 83 + 229
(really 231, fF. 66, 15 1 being repeated)+ 32 leaves.
Date : f. 314 V : sake 1633 ( = a. d; 1711)1
87 — MS. Wilson 117
Bhagavata Purana, A.D. 1686.
Contents: the text occupies the centre of each page,
the commentary filling top and bottom.
Measurement of binding : i6j X 6 ^ in.
No. of leaves : ii + 152 + ii blank. Originally 148 +
4 numbered leaves.
Date: f. I48 y (bis): sakabddh 1608 ( = a.d. 1686) 1
c 2
12
CATALOGUE OF SANSKRIT MSS.
88— MS - MiU 143
Bhagavata Purana, 19th cent.?
Contents : the MS. is very well ornamented.
Kept in a round cardboard box, 4 x 2 in. in diameter.
Measurement of roll: about 27 feet X 3^ in.
Character: Devanagari.
89 -MS. Mill 112°
Narayanavarma, 19th cent.?
Contents: printed in Brhatstotraratndkara, p. 144.
Measurement, Sfc.: this is part 11 of the MS. described
under 22.
90— MS. Walker 131 b
Bhaktiratnavali, 18th cent.?
Contents: see on MS. Sansk. c. 87.
The text is bounded on cither side by two red lines,
and the colophons are written in red ink. The last
colophon ends ’ratnavalyam sukamtimalamsampurnam
iti I After section 12 there are 13 (not 10) verses.
Measurement, Sfc.: this is part 2 of the MS. described
under 382 .
91— MS. Walker 157e
Bhaktiratnavali, 18th cent. ?
Contents : this contains a portion of the commentary
on the Bhaktiratnavali, attributed to Sridhara, but
really by Visnupuri, cf. on MS. Sansk. c. 87 (1332).
The text occupies the centre, the commentary the
top and bottom of each page. The text is bounded
on either side by two red lines.
Measurement, fyc.: this is part 3 of the MS. described
under 46 .
92— MS. Walker 208 cl
Harililaviveka, A. D. 1766.
Contents : see Eggcling, India Office catal., p. 1272.
Hemadri was srlkaraniidhipa of Mahadeva, Yadava
of Devagiri, a. d. 1260-1271, patron of Yopadeva,
Bhandarkar, Report, 1882, 1883, p. 36 ; Weber, Catal,
3 2 4 .
The text is bounded on either side by two red lines.
Measurement, Sfc.: this is part 5 of the MS. described
under 209 .
Rate: f. 139: samvata 1822 ( = a. d. 1766) varsa
pradviya - 1 Apparently the date of the exemplar.
93— MS. Wilson 493' 1
Durjanamukhacapetika, 19th cent.?
Contents: Colebrooke, quoted by Eggeling, India
(ffice catal, p. 1279, says that Maniram Tara attributed
the work to a Rama Krsna Bhatta, living about a. n. 1800
at Benares. Burnouf points out that the author dates
Yopadeva (1250) five centuries before his own time
(= ] 750), but this is not decisive against Rama Krsna.
Rarniisrama was a pupil of Bhattoji. Cf. the different
work in Aufrecht, Leipzig catal , p. 239.
Measurement, fyc.: this is part 4 of the MS. described
under 507 .
94— MS. Wilson 493*
Avataravadavali, 19th cent. ?
Contents: the guru of Purusottama, if he is the
famous Vallabhacarya, lived a. i>. 1478-1330. But
Mitra, Notices, IX, 120; Eggeling, India Office catal,
p. 810, have Vallabhanandana ( = Vitthalesa) son of
Yallabha, as the guru. Even this hardly suits an
author who cites Yisnupuri (a. d. 1634). The MS.
contains only chapter 13 of the work. Mitra gives
chapter 1 (f. 325), Prahastavada; Eggeling chapters 8
(Pratibimbavada), 10 (Brahjnanatvajatikhandanavada),
11 (Jivavyapakatvakhandanavada).
I Measurement, fyc.: this is part 6 of the MS. described
1 under 507 .
| Scribe : sec 304 .
95 —MS. Wilson 21
Matsya Purana, A. D. 1729.
Contents: see Haraprasada, Notices, I, 261-264;
Eggcling, India Office catal, pp. 1283 sq. Edited by
Jlvananda Y’idyasagara, Calcutta, 1876; and at Bombay
in 1895. The Purana is earlier than the nth century,
since Albiruni used it as a canonical work, sec Sach'au
in BuhlePs Manu, p. cxi.
The text is bounded on either side by a light red
line over two double dark lines.
Measurement of binding: 17x7^ in.
No. of leaves: ii +377+ ii blank. Really there are
only 37 6 as in the original foliation, but a blank leaf is
inserted after f. 3.
APPENDIX TO VOL. I (88-101)
13
96 — MS. Mill 106 b
Prayagamahatmya, A. D. 1717.
Contents: this forms chaps. 92-101 of the Matsya
Purana in the preceding MS.; chaps. 102-109 in Jlva-
nanda’s edition. In Eggeling, India Office catal.,
p. 1283, there are twelve chapters. Edited at Benares
in 1867 and 1870.
The text is bounded on either side by two black lines.
Measurement, fyc.: this is part 2 of the MS. described
under 100.
Date : f. ii5 v : samvat 1773 ( = a. d. 1717) pausasudi
10 gurau samapta \
Scribe: f.ii5 v : idampustakamupadhyanamdikesvara l
This may be the owner, or both scribe and owner.
97 — MS. Wilson 27
Markandeya Purana, 19th cent.?
Contents: see Eggeling, India Office catal., pp. 1284 sq.
Edited by K. M. Banerjea, Bibl. Ind., 1855—1862;
Jivananda Vidyasagara, Calcutta, 1879. Translated
by M. N. Dutt, Calcutta, 1897; by E. T. Pargiter, Bibl.
Ind., 1888 sq.
The text is arranged in three parallel rows horizontally.
Measurement of binding : 22f X 7 in.
Material: yellow country paper.
No.of leaves: ii + 195 + irblank. The original foliation
has only 194, f. 93 being merely a blank sheet which
has slipped in by mistake.
98 — MS. Walker 129*
Candikamahatmya, A. D. 1782.
Contents : a MS. of the Devlmahatmya of a.d. 998
is known, Haraprasada, Report, 1891—1895, p. 5. Cf.
Aufrecht , Leipzig catal., p. 84. Text published repeatedly
in India, e. g. at Bombay in 1861. For this commentary
cf. Mitra, Notices, III, 270, who takes Cakravartin,
probably correctly, as a mere, epithet. A Tomara
prince, Uddharanadeva, about a. d. 1350 is known,
Duff, Chronol. of India , p. 306.
The text is bounded on either side by three red
lines. It is written in two different styles: (1) ff. 1-49^,
81—i5o v ; (2) ff. 5 <o-8o v .
Measurement of binding: 11 x 6-| in.
No. of leaves: ii + 237+ ii blank. The nine parts
in the original foliation have 150+15 + 9 + 20+15 + 1 +
4 + 11 + 12 leaves.
Date: f. 150: samvat 1838 ( = a. d. 1782) varse
margasirsasudi 3 ravau likhitam 1
Scribe: f. 150: agnihotrivydsatulasisutabhudevanamna
likhitam asti I srlmahamaya asdpurdji satyache \ Usual
style of this scribe’s MSS.
99 — MS. Wilson 488*
Candikamahatmya, A.D. 1804.
Contents: the text is bounded on either side by
two blue or red lines. Ff. 4, 7, 9, 14 are on yellow
paper. Written by a very ignorant scribe.
Measurement of binding: 6-| x 5 in.
No. of leaves : ii + 71+ii blank. The two parts in
the original foliation have 56 + 15 leaves.
Date : f. 56 v : srisamvat i860 (a. d. 1804) l
100 —MS. MiH 105 a
Devlmahatmya, 19th cent.?
Contents: the text is bounded on either side by two
double red lines.
Measurement of binding : 7 j X 5-5- in.
No. of leaves: ii + 115 + ii blank. The two parts in
the original foliation have 84 + 32 (really 31, f. 1 being
lost) leaves.
Date: f. 84 v : vaikhamdse suklapakse saptamydm
sanavdre I Probably about the beginning of the 19th
century.
Scribe : f. 84 v : Rama for Ramadayala apparently:
aleva tra ('<!) Rdmena pathartha Ramadayala \
101 —MS. Wilson 100
Lihga Purana, 18th cent. ?
Contents: in Aufrecht, Leipzig catal., p. 87, the
parts have 103 + 53 chapters. Printed with Ganesa’s
S'ivatosani, Poona, 1876, and Madras, 1879. Edited
by Pancanana Tarkaratna, Calcutta, 1891. Part 2
begins on f. 283. On its relation to the Mahabharata
which it copies, see Holtzmann, Mahabharata, IV, 52.
The text is bounded on either side by two double
red lines. The titles have been wrongly altered to
uttara and purva. _____
Measurement of binding : 12^ x Jj in.
No. of leaves: ii + 380+ ii blank. The original
foliation has 283 (really 282, as there is no f. 222)+ 98
leaves.
14
CATALOGUE OF
102— MS. Wilson 127 a
Vamana Purana, A. D. 1703.
Contents : see Eggeling, India Office catal., p. 1298 ;
Mitra, Notices , III, 267. Edited, with Bengali prose
translation, by Thakuradasa Cudamani, Calcutta, 1886.
The text is bounded on either side by two double
red lines. —
Measurement of binding : 147 x 87 in.
No. of leaves : ii + 196 + ii blank. The two parts in
the original foliation have 125 + 71 leaves.
Bate: f. 125: samvata 1819 ( = a. d. 1763) samaye
caitrudima.se krsnapakse dvitiyam vara guru 2 1
Scribe: f. 125: Kasimadhye Cauppambhdmadhye
fikha jodavaso likhi l
103— MS. Wilson 355
Vayu Purana, 15th cent.?
Contents: the Vayu Purana is cited in and copied
by the Mahabharata, III, 191, 16 (see Ilopkins, Epic
of India , p. 48), and the Ilarivamsa, and its existence
in some shape is proved by Bana (a. d. 620); see
also Biihler, Manu , S. B. E., XXV, xci, note. It is
closely followed by the Ilarivamsa, Wilson, Visnu-
purana , III, 165; Iloltzmann, Mahabharata , IV, 40.
Edited by llajendralfda Mitra, Bib/. Ind., 1880-1888,
and at Bombay in 1895. See Eggeling, India Office
catal. , pp. 1299 sq.; Wilson, Essays , I, 140 sq., who
describes it.
The text is bounded on either side by two or four
black lines. F. 162 has been recently supplied. A good
many lacunae are marked.
Measurement of binding : 12 X 6 * in.
No. of leaves: ii+162 +ii blank. The original
foliation makes 163, but f. 79 is now lost.
Injuries: ff. 134—140 are much damaged by ants.
104 —MS. Wilson 120
Vayu Purana, 10th cent. ?
Contents: the text is bounded on either side by
two broad red lines.
Measurement of binding : 14-j x 9 in.
No. of leaves: ii + 270 + ii blank. The original
foliation makes 271 ff., as there is no f. 218.
105— MS. Walker 169
Varaha Purana, 18th cent.?
Contents: edited by Hrsikesa Sastrin, Bibl. Ind.,
1 ^93- Cf. Mitra, Notices, III, 285, Bikaner catal..
SANSKRIT MSS.
p. 218. It follows the Bhagavadgita, and is perhaps
used by the Bhagavata, Holtzmann ,Mahabharata, IV,53.
The text is bounded on either side by two red lines.
As an example of the difficulty of dating the Puranas
in their present form even relatively, it may be noted
that the Bhavisya Purana cites Varaha, Bodl. catal.,
p. 35, while Varaha mentions the Bhavisya.
Measurement of binding: 12 X in.
No. of leaves : ii + 403 + ii blank.
Scribe: f. 4C>3 V : likhitam Bahjyadurammah l
106 —MS. Wilson 101
Varaha Purana, A. D. 1821.
Contents: ff. 115, 178, 197 are blank, but nothing
is missing. Four hands can be distinguished.
Measurement of binding : 137 X 107 in.
No. of leaves: iv +264 +v blank. In the original
foliation 261, as the blanks are not numbered. Arranged
like a European book.
107 —MS. Mill 77 1 ’
Mathuramahatmya, 18th cent.?
Contents : the text is bounded on either side by
two black lines. F. 6o v is blank. It ends quite
abruptly on f. 74 v with verse 31 of chapter 19. See
f. 850 of the Bibl. Ind. edition. Printed separately,
with a Hindi version, Mathura, 1882.
Measurement, Sfc.: this is part 2 of the MS. described
under 722.
108 —MS. Min 42c
Mathuramahatmya, 19th cent. ?
Contents: the MS. has been corrected by the first
hand with yellow pigment.
Measurement, fyc. ; this is part 3 of the MS. described
under 71.
109 —MS. Wilson 108
Visnu Purana, A. D. 1703.
Contents: the text is bounded on either side by two
double red lines.
Edited, with S'rldliarasvamin’s commentary, by
Anantanarayana Sastrin and Ilamasvamin Sastrin,
Madras, 1854, and by Jivananda Vidyasagara, Calcutta,
1882; also at Bombay in 1887, and at Calcutta in 1888.
15
APPENDIX TO VOL. I (102-118)
Translated into English by M. N. Dutt, Calcutta, 1894.
Cf. Holtzmann, Mahabhdrata, IV, 36-40.
Measurement of binding : 147 x jj in.
No. of leaves : ii + 216 + ii blank.
Date: f. 216: samvatu 1759 ( = a. d. 1703) varse
jyestavadi 14 gunivasare bharate nachitre tadina pausti-
kam saniapto \yam krtvd subham astu mamgalam \
110 —MS. Wilson 107
Visnu Purana, A.D. 1740.
Contents: the text is rather inaccurate. It is
bounded on either side by two double red lines, and
the margin is covered over with yellow pigment.
Measurement of binding : 137 X 6-^ in.
No. of leaves: ii + 236 + ii blank. The original foliation
makes 240, as If. 3-25 are replaced by ff. 3-21.
Date: f. 236 : samata 1760 ( = a. d. 1704, not 1740
as Bodl. catal .) samai pudra 2 vadi sdtmi pothl samdpta l
Scribe: f. 236: likhltam Puramda kdestha srivastaka 1
Kdslmaddhaim \
HI—MS. Wilson 130
Visnu Purana, 18th cent. ?
Contents: for this combination of the two com¬
mentaries, cf. Eggeling, India Office catal., p. 1310;
Weber, Catal., I, 144; and the Calcutta edition of
1867 sq., in all of which I, II, V, YI are Sridhara’s.
The whole of S'ridhara is contained in the Calcutta
edition, 1882.
The text occupies the centre of each page, the
commentary the top and bottom. It is bounded on
either side by a light red line over three or four dark
red lines.
Measurement of binding : 13^ x 8j in.
No. of leaves: ii + 387+ ii blank. Originally each
amsa had its own foliation: 90 + 58 + 59 + 64 (f. 65 is
lost and a blank leaf is inserted) + 79.
112— MS. Wilson 20
Visnu Purana, 18th cent.?
Measurement of binding : 20 X Jj in.
Material: yellow country paper.
No. of leaves: ii + 156 + ii blank.
113— MS. Walker 204
S'iva Purana, A.D. 1770.
• Contents: the work consists only of seventy-four
chapters. On f. 140 v the number 59 has been wrongly
altered into 60, which has led the Bodl. catal. to say
that chaps. 59, 60 relate the death of Hiranyakasipu,
&c. Printed at Bombay in 1884, with a commentary.
Cf. on MS. Sansk. c. 57 (1180), and Eggeling, India
Office catal., pp. 1311 sq., who thinks this is the uttara-
bhaga of the Rudrasamhita.
The text is bounded on either side by two dark red
lines.
Measurement of binding : 107 X 67 in.
No. of leaves : ii + 177 + ii blank.
bate: f. 177: samvat 1826 ( = a.d. 1770) nd varse
posamdse (corrected from maga 0 ) Suklapakse 9 Sanau 1
Scribe : f. 177 : pathanartham Vydsasri 5 tulasisuta-
bhudeva likhdvitam l In the Bodl. catal. this is taken
to give the scribe’s name, but properly it should be his
patron’s. Still the writing is just the same as in
those places where he is said to have written himself,
and likhdvitam probably means no more than likhitam.
114-116— MSS. Walker 140-142
Revamahatmya, 17th and 18th cent.?
Contents: the Rsisrngasvargagamana referred to on
f. 66 ft , is different from the usual legend, Gottingische
Nachrichten, 1897, p. 109. This work has no real claim
to belong to the ancient Vayu Purana, quoted by Bana.
Cf. Mitra, Notices, VII, 21—26. It is a good example
of the mode of the growth of Puranas.
In the old part the text is bounded on either side by
two red lines.
Measurement of binding: 1 1 \ x 6^ in. approximately
for each volume.
No. of leaves : 140 = ii + 258 + ii blank ; 141=ii + 233
+ ii blank ; 142 = ii + 217 + ii blank. In the original
foliation the whole is numbered continuously, making
ff. 727, of which ff. 337, 646-665 are missing. In the
latter place nothing seems to be lost.
117— MS. Wilson 489
Gayamahatmya, 10th cent.?
Contents: see MS. Sansk. d. 58 (1187); Eggeling,
India Office catal., p. 1301; Aufrecht, Leipzig catal.,
p. 90. In the Bibl. Ind. edition of the Vayu Purana
it forms adhyayas 43-50 of the Uttarakhanda.
Measurement of binding : 9^ x 6£ in.
No. of leaves : i + 30 + i blank.
118— MS. Mill 42b
Gayamahatmya, 19th cent. ?
Contents : the text is bounded on either side by two
or four red lines. The chapters end on ff. 25 (42 verses),
16
CATALOGUE OF SANSKRIT MSS.
29 (82 verses), 3i v (53 verses), 34 v (68 verses), 37''
(52 verses), 40 (60 verses), 45 (96 verses).
Measurement, Sfc.: this is part 2 of the MS. described
under 71 .
119— MS. Walker 181 a
Katyayanlmahatmya, A. D. 1709.
Contents: the text is bounded on either side by
three red lines. ____
Measurement, fyc.: this is part 1 of MS. Walker 18 r
( 1046 ).
hate: f. $6 X : samvat 1765 varse sake 1630 ( = a. d.
t 708) pravarttamane daksindyanagate srlsurye masotta-
mamargaslrsavadi 10 gurau lisitam l
120-122— MSS. Wilson 95-97
Kasikhanda, A. D. 1792.
Contents: Eggeling, India Office catal., p. 1331,
points out that the correspondence in the number of
leaves of the MSS., especially of the Uttarabhaga, can
only be explained by derivation from one original.
So Mitra, Notices, VI, 255 (uttarabh 0 ); Burnell, Tanjore
catal., p. I94 v (both); MS. Sansk. b. 1 ( 1193 ); cf.
Bhandarkar, Report, 1882, 1883, p. 57 (314 ff., probably
a slip). As Burnell says, the commentary is a modern
production, probably of the 16th century. Printed,
with commentary, at Benares in 1868, Bombay, 1881,
Calcutta, 1873-1880. There exists a MS. of the
Ambikakhanda of this Purana which is as old as the
7th century according to Bendall, Ilaraprasada, Report,
1891-1895, p. 4.
The text is bounded on either side by two red lines.
The commentary is written at the top and bottom of
the pages.
Measurement of binding : 13^- x 8j in. approximately
for each volume.
No. of leaves :
95 = ii +318+ ii blank. In the original foliation
there are also 318 leaves, but f. 60 is repeated, and there
is no f. 133.
96 = ii + 309 + ii blank. Numbered consecutively to
629 in the original foliation, there being no If. 320, 467.
97 = ii + 252 + ii blank.
Date: 97 , f. 252 : sanivat 1848 (= a. d. 1792) miti
phdlgunasudi 10 l
123 -MS. Wilson 109 a
Gurugita, 18th cent.?
Contents : the MS. is made up of alternate sheets
of yellow and white paper, beginning with the former.
Cf. Weber, Catal., I, 315 ; Aufrecht, Leipzig catal.,
pp. 97, 98 (142 and 189 verses); Winternitz, R.A.S.
catal., p. 38.
Measurement of binding : 16] x 4^ in.
No. of leaves: ii + 75 + ii blank. The two parts have
i6 + 59leaves.
Scribe: not by the same hand as part 2.
124— MS. Walker 144*
Dvarakamahatmya, A. D. 1770.
Contents: cf. Eggeling, India Office catal., p. 1356.
Measurement, fyc.: this is part 1 of MS. Walker 144
( 1048 ).
Date: f-99 v : savat 1826 varsesake 1692 ( = a.d. 1770)
pravarttamanye sravanamase krsnapakse navaml budha-
vasare pustaka samdptah 1 Ilumdnajisatyachah 1
125— MS. Wilson 119 a
S'ambhalamahatmya, A. D. 1762.
Contents: see Mitra, Notices, V, 59. The place
celebrated is the modern Sambhalpur in the Central
Provinces. Printed at Sambhalpur in 1885.
The text is bounded on either side by two double
red lines. The slokasamkhya is 1525.
Measurement of binding: 16 X 7 in.
No. of leaves : i + 42 + i blank. The two parts in
the original foliation have 37 + 5 leaves.
Date: f.37: sanivat 1818 ( = a.d. i 762) samaye agaha-
namase suklapakse ekddasyam 11 1
Scribe: f. 37 : Kdsimadhye Rdmaghdtaparalisd pusta-
kaniGovarddh((namisrendtmapafhandthumparopakardya\
126— MS. Walker 160
Brhadbrahmottarakhanda, A.D. 1770-1780.
Contents: the text is usually bounded on either side
by two red lines.
Eggeling, India Office catal., p.1356,describes another
copy of this version. The ascription of the Bhagavata to
Vopadeva is impossible: it is cited already by Hemfi-
dri, Aufrecht, Catalogus Catalogorum, p. 402, and all the
evidence goes to show that the Puranas not only contain
old material, but were reduced to their present form com¬
paratively early. Cf. Iloltzmann, Mahdbharata, IV,29 sq.;
Hopkins, Epic of India, pp. 47 sq. The eighteen Maha-
puranas are known to the epic (XVIII, 5, 46; 6, 97),
and though doubtless much altered, their material is
APPENDIX TO VOL. I (118-133)
17
not in all probability fundamentally different from what
it was about a. d. 300.
Measurement of binding: 11 f x 7 in.
No. of leaves: ii + 192 + ii blank.
127 — MS. Walker 132d
Laghufiiva Purana, A. D. 1770.
Contents: the text is bounded on either side by
three red lines. The hand is slightly different from
Bhudeva’s.
See Weber, Catal., II, 136, 137; Mitra, Notices,
VIII, 19; Eggeling, India Office catal., pp. 1356 sq.
Printed at Bombay in 1880, &c.
Measurement, fyc. : this is part 4 of the MS. described
under 38.
Date: f. 190: samvat 1826 nd varase sake 1692
( = a. d. 1770) pravarttamane vaisasamase krsnapakse
11 tithau somavasare I
128 — MS. Wilson 104 b
Laghusiva Purana, 19th cent. ?
Contents : the text is bounded on either side by
a broad red or yellow line over two double dark red lines.
Former owner: f. 202 y : srimatgovindaramena dattam 1
This is in a later hand than the text.
Measurement, fyc. : this is part 2 of the MS. described
under 48.
129 — MS. Mill 9
S'iva Purana, 19th cent. P
Contents : f. 258 contains only scraps, mostly in¬
vocations. For part 3 see Eggeling, India Office
catal., p. 1314; Burnell, Tanjore catal., p. 203k. The
other parts cannot be yet identified. Cf. for the twelve
samhitas, Mitra, Bikaner catal., p. 209; Aufrecht,
Catalogus Catalogorum, p. 650; Bendall, Brit. Mus.
catal., p. 38.
Measurement of binding : 15^ X 5-I in.
Material : yellow country paper.
No. of leaves : i + 258 + i blank.
130 — MS. Walker 134
S'rimalamahatmya, 18th cent. P
Contents: the two hands have done ff. 1—118, and
ff. 119 to the end respectively. It is possible that
■ODL. SANS. CATAL. APP.
even in part 1 two hands must be distinguished, the
one doing ff. 1—57, the other ff. 58—118, but this may
merely be a difference of style. In this portion the
text is sometimes bounded on either side by two red
lines. Ff. 44—48^ belong to the second hand. Ff. 12,
25, 26, 27, 28, 29, 30, 34 are blank. Ff. 31-34 have
been recently, supplied. There are some corrections in
a recent hand.
Measurement of binding :■ lof x 7f in.
No. of leaves: ii-f- 171 + ii blank. The original foliation
makes only 162, as ff. 36—39 are repeated, and after
f. 39 there are four unnumbered leaves.
Scribe: f. I7i v : lasitam purohitakumvarajivastd \
131 —MS. Wilson 109 b
Kapila Samhita, 19th cent.?
Contents: see Mitra, Notices, IV, 1. The MS. is
on yellow country paper.
Measurement, fyc.: this is part 2 of the MS. described
under 123 .
132 — MS. Wilson 128
Kalika Purana, A. D. 1821.
Contents: see the analysis in Eggeling, India Office
catal., pp. 1189 sq.; Mitra, Notices, I, 80. Printed at
Bombay in 1891.
The text is bounded on either side by three red lines.
Measurement of binding: 137 X 87 in.
No. of leaves: ii + 317 -f ii blank.
Date : f. 317 : satamo 1877 ( = a.d. 1821) samonamase
vanasupachapu l
133 — MS. Wilson 351
Gane£a Purana, A.D. 1801.
Contents: H. H. Wilson, Visnvpurana 2 , 1, xc, ascribes
its origin to the Ganapatya sect. Described further
by Stevenson, Journ. Royal As. Soc.,YllI, 319 sq. It
is not recognized in the south, Burnell, Tanjore catal.,
p. 187b. See also Mitra, Notices, VII, 92-96 ; Holtz-
mann, Mahabharata, IV, 57. Only the Ganesaglta
( = chapters 139-148, Bodl. catal., p. 79^) has been
printed (Poona, 1887). Written by at least three hands.
Measurement of binding: 12- X 5^ in.
No. of leaves: ii + 98 4- ii blank.
Date: f. 98: herambhah miti ca'itavaddi 13 vara
atavdrakem pothi sammaptak 1857 ( = a. d. 1801) 1
D
18
CATALOGUE OF
134— MS. Wilson 350
Kridakhanda, A. D. 1801.
Contents: the MS. has obviously been written
simultaneously by three or four scribes, in different
styles, but always inaccurately. Sometimes the text
is bounded on either side by two double red lines.
Measurement of binding: i2^-X5jin.
No. of leaves: ii4-2ii 4-iii blank. The original
foliation makes 208, as there is no f. 69 and f. 72 is
five leaves.
Date: f. 21 i v : samvat 1857 ( = a. d. 1801) varse
bhadavasrudi 2 ravivasare likhatam l
135— MS. Wilson 243c
Ganesasahasranaman, 19th cent. ?
Contents: the MS. is a good deal corrected by
a later hand. Red ink is used for the colophons.
Measurement, fyc.: this is part 3 of the MS. described
under 491.
Scribe: f. 75 : lipikrtam Radhukrsna desavuli.
136— MS. Wilson 110 b
Devlbhagavata Purana, 19th cent.?
Contents : see Wilson, Visnupurdna 2 , I, xlvii sq.;
Mitra, Bikaner catal., pp. 193 sq., who gives an account
of the twelve skandas of w hich it consists ; Weber,
Catal., I, 139, II, 126-132; Eggeling, India Office
catal., p. 1207. Edited at Bombay in 1880, with Nlla-
kantha’s commentary. This work borrows most of
its second book from the first of the Mahabharata,
Iloltzmann, Mahabharata, IV, 57, and is later even
than the Bhagavata.
Measurement, Sfc.: this is part 2 of the MS. described
under 49.
Scribe : the main hand is identical with that of part
1, but ff. 138-177 are in quite a different style.
137—MS. Wilson 490
Nandisvara Purana, A. D. 1798.
Contents: quoted in Devlbhagavata Purana, I, 3,15
(7 )odl. catal., p. 8o a ), Hemadri, Madhavacarya, Raghu-
nandana, &c. (Aufrecht, Catalogus Catalogorum, p. 276),
and therefore probably at least as old as the nth or
12th century. On a use of ca = iva see Aufrecht,
Z. D. M. G., LII, 273, 274. The author seems to know
SANSKRIT MSS.
the Mahimnahstava, see Aufrecht, Leipzig catal.,
p. 117 (21 chapters only).
The text is bounded on either side by two red lines.
Ff. 1, io2 v are ornamented with line patterns.
Measurement of binding : 8-^ x 4^ in.
No. of leaves : ii 4-102 4-ii blank. In the original
foliation 101 leaves, f. 88 being double.
Date: f. 102: samvat 1834 (= a. d. i ygS)jyechasu 1 o 1
138— MS. Walker 158
Narasimha Purana, 18th cent.?
Contents: seeEggeling,/>K/iaO#meca/a/.,pp.i2i 1 sq.;
Mitra, Notices, III, 1-5, Bikaner catal., p. 207 (3,136
slokas, 41 chapters); Burnell, Tanjore catal., p. 188;
generally recognized as a leading Upapurana. Mitra
says it has been recognized as an authority for over
1000 years, which agrees well with the fact that it is
cited in the Matsya Purana, Bodl. catal., p. 4c 1 '.
Printed in Grantharatnamdld, Bombay, 1887-1889.
The text is bounded on either side by two red lines.
Measurement of binding : 11 - x 6 j in.
No. of leaves : ii 4-131 4- ii blank.
139— MS. Wilson 353
Narasimha Purana, 19th cent.?
Measurement of binding : 1 i-j x 9^ in.
Material: paper water-marked ‘S. Wise & Co., 1821
No. of leaves : ii 4- 74 4- ii blank. Arranged like
a European book.
. 140— MS. Wilson 118
Naradlya Purana, A. D. 1762.
Contents: the second part has thirty-seven chapters ;
for its relation to the India Office MS. see Eggeling,
India Office catal., pp. 1209-1211, on information
received from Prof. Macdonell. For part 1, see Burnell,
Tanjore catal., p. i88 a . This is the Narada Upapurana,
apparently different from the Brhannaradlya, which
how r ever in its second part, chap. 9 sq., contains
a somewhat similar narrative. See on 47.
Measurement of binding : 16x7-^ in.
No. of leaves: ii 4- 72 4- ii blank. In the original
foliation 434-29 leaves.
Date:
(1) f. 43 v : samvata 1818 ( = a.d. 1762) samaye
maghavadi 2 l
(2) f. 72: samvat 1818 l
APrENDIX TO VOL. I (134-150)
10
141 —MS. Wilson 110 b
Vasisthalainga, 10th cent.?
Contents: see Mitra, Notices , V, 77, 78. Chapter I,
ends on f. 39; II, on Maya, on f. 39 v ; III, on S'iva as
the para tattva, on f. 4i v ; IV, on the worship of S'iva
on the lunar days, on f. 42 v .
The text is bounded on either side by two double
red lines.
Measurement, fyc.: this is part 2 of the MS. described
under 125.
Scribe : earlier than that of part 1.
142— MS. Mill 70
Index to the Puranas, 10th cent.?
Contents : see Eggeling, India Office cat at., pp. 1413,
1414. Ff. 1-3 contain a list of Puranas.
Measurement of binding : 10J, X 7 in.
No. of leaves: iii + 260 + ii blank.
143,144 —MSS. Wilson 357, 358
Puranasarvasva, 10th cent. P
Contents: probably the archetype of this MS. was the
MS. described by Eggeling, India Office catal., p. 1410,
which was written in a.d. 1807 by Riidhanathasarman.
Measurement of binding : io| x 8| in.
Material: yellow country paper.
No. of leaves : 357 has i + 271+ii blank ; 358 has
i + 225 + ii blank.
145— MS. Wilson 47
Rudrayamala Tantra, 10th cent. P
Contents: cf. Haraprasada, Notices, I, pt. iii, pp. xxxv,
327 sq. Anything in the Tantric style may be referred
to this work, see Aufrecht, Catalogus Catalogorum,
PP- 53 T > 53 2 > Hj 124-126, 222. In some form it
appears to be of fairly respectable antiquity, perhaps
of the 10th century, or even earlier.
In the centre of each page is the usual blank square.
Measurement of binding : 2o| x 6 in.
Material: yellow country paper.
No. of leaves: ii + 248 + ii blank. The original foliation
makes 249 leaves, as there are no ff. 16, 106, 233 and
ff. 21, 217 are repeated.
146— MS. Mill 112"
S'akta Prayers, A.D. 1817.
Measurement , Sfc. : this is part 10 of the MS. described
under 22.
147-ms. Wilson 254
Kul&rnava Tantra, A. D. 1760.
Contents : see Eggeling, India Office catal., p. 879 ;
Mitra, Notices, I, 138,160; Winternitz, R.A.S. catal.,
p. 50. There is a copy in the Indian Institute Library,
Keith, Ind. Inst, catal., p. 41.
The text is bounded on either side by two broad red
lines, and the colophons are usually written in red ink.
Measurement of binding : 11 j X in.
No. of leaves : ii + 80 (really 79, as there is no f. 60)
+ ii blank.
148 —MS. Wilson 300
Krkalglsadipika, 10th cent. ?
Contents : the title is Krkalasadipika, see Prdnatosini ,
p. 2, in Aufrecht, Catalogus Catalogorum, p. 114.
Measurement of binding: iOj X 5 j in.
Matei'ial : yellow country paper.
No. of leaves : ii 4 - 40 + ii blank.
149— MS. Wilson 40
Tantrasara, A.D. 1812.
Contents : Weber’s MS. was revised by Amrtananda,
but, as Eggeling, India Office catal., p. 885, points out,
this does not prove that the recension found in the other
MSS. was due to him. Cf. Mitra, Notices , II, 326 ;
Aufrecht, Leipzig catal., p. 409. There is a copy in
the Indian Institute Library, Keith, Catal., p. 43.
Lithographed at Benares in 1867, and edited by
Rasikamohana, Calcutta, 1879-1886.
In the centre of each page is a square blank space,
with a hole in the centre.
Measurement of binding : 19 ^ X 5 ^ in.
Material : yellow country paper.
No. of leaves : ii + 235 + ii blank. The original
foliation makes 257, i.e. 245 numbered and 12 unnum¬
bered, as it has no f. 65, or f. 85, or ff. 208-226.
Date: f. 245 v : sakdbdah 1734 (=a.d. 1812) I
150 — MS. Wilson 41 c
Todala Tantra, 10th cent. ?
Contents: cf. Mitra, Notices, I, 217. Quoted in
Saktanandatarangini, Bodl. catal., p. I04 a .
Measurement, fyc. : this is part 3 of the MS. described
under 151 .
Scribe: by the same hand as 157.
D 2
20
CATALOGUE OF
151— MS. Wilson 41*
PhetkarinI Tantra, 19th cent.?
Contents : in Deviprasada’s Oudh catal., XI, 26, it
is assigned to Bhairavacarya.
Measurement of binding : i6|-X5y in.
Material: yellow country paper.
No. of leaves : ii + 146 + ii blank. The three parts
in the original foliation have 53+67 + 26 leaves.
152— MS. Mill 112^
Ramasahasranamastotra, A.D. 1817.
Contents: this Brahmayamala is quoted in the
Rudrayamala, and by Narapati, Aufrecht, Camb. catal.,
j). 70, and therefore cannot be later than the 10th
century. See also Aufrecht, Leipzig catal., p. 398
(198 verses); Bendall, Brit. Mus. catal., pp. 234, 235.
Measurement, Sfc.: this is part 7 of the MS. described
under 22.
153— MS. MiU 112 p
Ramakavaca, A.D. 1817.
Contents: quite different from the works described in
Aufrecht’s Leipzig catal., pp. 211, 212.
Measurement, fyc.: this is part 12 of the MS. described
under 22.
154— MS. Wilson 300 b
Mantramahodadhi, A. D. 1814.
Contents : the date on f. 196 is samvat 1645 ( = a. d.
1589, not 1586 as Aufrecht, Flor. catal., p. 135).
Printed at Benares in 1863. Cf. also Mitra, Notices,
III, 246 ; Eggeling, India Office catal., p. 885 ; Bendall,
Brit. Mus. catal., pp. 45, 46, where the work is dated
A.D. 1597. -
Measurement, 8 fc.: this is part 2 of the MS. described
under 160.
Date: f. 196 : sakubddh 1736 (=a. d. 1814) I
Scribe: f. 196: likhltam sripildmbarasarmmand \
155— MS. Mill 43
Nauka, 19th cent. P
Contents : see Eggeling, India Office catal., p. 885;
Mitra, Notices, IV, 295, Bikaner catal., p. 595. Edited
at Benares in 1879, by Balamukunda Malavl, and in
the Vividhatantrasamgraha, no. 29. The commentary
was written nine months after the text, Aufrecht,
Leipzig catal., p. 445.
Measurement of binding : 12-^-X 5| in.
Ao. of leaves: i + 63 + i blank.
SANSKRIT MSS.
150—MS. Wilson 630
Togini Tantra, 19th cent.P
Contents : this appears to be chapter 16 of the first
part of the Yogini Tantra, which has nineteen patalas,
while the second part, Kamarupadhikara, has at least
fifteen chapters, Eggeling, India Office catal., p. 866.
In Mitra, Notices, VI, 279, patala 9 of this is said
to occur in the dvitiyabhaga, which is probably a slip.
There seems to be no authority for the statement,
Catalogus Catalogorum, II, 112, that the second part
of patala 19 is called Kamarupadhikara, though it is
possible. See also Bendall, Brit. Mus. catal., p. 236.
Measurement of binding : 13^ X 6 in.
No. of leaves: ii + 5 + ii blank.
157 —MS. Wilson 41 b
S'aktiratnakara, 19th cent.P
Contents: see also Mitra, Notices, I, 127, 128.
Measurement, Sfc.: this is part 2 of the MS. described
under 161.
158— MS. Wilson 323 a
S'aktisangama Tantra, 19th cent.?
Contents: see for this tantra Eggeling, India Office
catal., pp. 890, 891; Mitra, Notices, I, 229, Bikaner
catal., p. 606.
Measurement of binding: 13^ X 9f in.
Material: paper water-marked ‘ S. & C. Wise/
No. of leaves : iii + 26 + iii blank. The two parts
in the original foliation have 2 + 24 leaves. Arranged
like a European book.
Date: the latest water-mark is 1810.
159— MS. Wilson 247
S'aktanandatarahgini, 19th cent.P
Contents : see Mitra, Notices, IX, 256-258. Litho¬
graphed at Benares in 1878.
In the centre of each page a square blank space is left.
Measurement of binding : 14I- x 5^ in.
Material: yellow country paper.
No. of leaves: ii + 144 + ii blank.
160— MS. Wilson 300*
S'aradatilaka, A.D. 1814.
Contents: according to Mitra, Notices, II, 145, the
author Mas Laksmana Desikendra, son of Srlkrsna,
son of Vijayacarya of the Varendra clan.
21
APPENDIX TO
The work is tolerably old as it is quoted by Sayana
(14th cent.). Cf. Aufrecht, Leipzig catal ., p. 409.
Measurement of binding: 13 x 9^ in.
Material: paper water-marked £ Budgen & Wilmott.*
No. of leaves: i +196 + i blank. The two parts
in the original foliation have 99 + 96 leaves. Arranged
like a European book.
Bate: the year 1814 is probable, as 154 was written
then. The paper is water-marked 1809, so that 1799
is impossible.
Scribe: f. 99 v : likhitam sripitambarabhattdcaryyena \
161 —MS. Mill 112 f
Ramacandrastavaraja, A. D. 1817.
Contents: printed in Brhatstotraratndkara, p. 281.
See Aufrecht, Leipzig catal., p. 106, no. 341 (100 verses),
and no. 342 (from Hiranyagarbhasamhita).
Measurement, fyc.: this is part 3 of the MS. described
under 22.
162— MS. Mill 1121
Janaklsahasranamastotra, A. D. 1817.
Contents : the Siddhesvara Tantra is quoted in the
Tantrasara, Bodl. catal, p. 95^.
Measurement, SfC. : this is part 8 of the MS. described
under 22.
163— MS. Wilson 322
Hanumatpaddhati, 19th cent.?
Contents : for the Uttarakhanda of this Sudarsana-
samhita see Mitra, Notices, VII, 54, 55. For a Sudar-
sanakavaca from it, see Aufrecht, Leipzig catal., p. 461.
Measurement of binding: ii-^-X 9! in.
Material: paper water-marked c J, Budgen.*
No. of leaves: iii+14 +v blank. Arranged like
a European book.
Bate: the latest water-mark is 1805.
Scribe: nos. 158 , 103 , 331 seem all to be by the same
% hand.
164— MS. Mill 112 r
Hanumatkavaca, A.D. 1817.
Contents: see Aufrecht, Leipzig catal., p. 21; Bendall,
Brit. Mus. catal, p. 48 [140 (F)]. No. 1380, in the
Leipzig catal., p. 461, seems to be different.
Measurement, fyc. : this is part 14 of the MS. described
under 22.
VOL. I (151-169)
165— MS. Mill 112<1
Laksmanakavaca, A.D. 1817.
Measurement, fyc. : this is part 13 of the MS. described
under 22.
166— ms. Min 112 m
Gayatrimantra, A.D. 1817.
Contents : see Aufrecht, Flor. catal., p. 55, for a fuller
account. __-
Measurement, 8fc.: this is part 9 of the MS. described
under 22.
167— MS. Walker 101 b
Pavanavijaya, A.D. 1370.
Contents: see MS. Sansk. d. 193 ( 1692 ). The various
works with this title have very varying numbers of
verses ; Mitra, Notices, I, 277, has 292, Bikaner catal.,
p. 708, seems to be shorter. On f. 63? a lacuna is
marked. The work must be of very respectable anti¬
quity. The MSS. described by Aufrecht, Leipzig
catal, pp. 462-464, have from 227 to 351 verses.
Measurement, 8fC.: this is part 2 of the MS. described
under 384.
Bate: f. 64 v : samvat 1426 ( = a.d. 1370) varse
pausavadi 2 (or 1 V) sukre Pavanavijayasya pustikd
lakhita l
Injuries: many worm-holes.
168 —MS. Wilson 243 b
Anandalaharl, A.D. 1097.
Contents : for the commentary cf. Aufrecht, Leipzig
catal, p. 282; Mitra, Notices, IV, 299, Bikaner catal.,
p. 245; Eggeling, India Office catal., p. 914.
The text occupies the centre of each page, the
commentary the top and bottom. The writing* is
bounded on either side by two double red lines.
Measurement, fyc.: this is part 2 of the MS. described
under 491.
Bate: f 59: samvata 1753 (= a. d. 1697) margasirse
mdsi krsne pakse dasamyam ravivasare \
Scribe : f. 59 : likhitam idarrt pustakam panditagiri-
dharena l
Injuries: a good deal stained by water..
169— MS. Walker 179 a
Anand&lahari, A.D. 1779.
Contents: the text is bounded on either side by
three red lines.
Measurement of binding: 11x6^ in.
22
CATALOGUE OF
No. of leaves : ii + 229 + ii blank. The five parts in
the original foliation have 5i+45 + 8 + 3 I+ 93 leaves *
Bate: f. 51 : samvat 1835 (=a.d. 1779) nu varse
caitravadi 1 gurau l
Scribe : f. 51 : lakhdvitam agnihotrlvyasasrl 5 tulasl
sufabhudeciramjh'i 1 Probably lakhdvitam simply means
written. Cf. 113.
170—MS. Mill 2 ft
Anandalahari, 19th cent. ?
Contents: the commentary seems to be identical
with the Manjubhasini of Krsnacarya, son of Vallabha,
described by Mitra, Notices, YII, 174, but not with
that of Eggeling, India Office catal., p. 915.
Measurement of binding : 16j x in.
Material: yellow country paper.
No. of leaves : i + 79 + i blank. Originally the parts
were paged severally, part 1 having 48 (+ 7 blank),
part 2, 100 (4-3 blank).
171 —MS. Mill 62 e
Anandalahari, 10th cent.?
Measurement, fyc.: this is part 5 of the MS. described
under 564.
Scribe: cf. 544.
172— MS. Wilson 328 c
Anandalahari, 19th cent.?
Measurement, fyc.: this is part 3 of the MS. described
under 235.
Material: European paper.
Date: the latest water-mark is apparently 1822.
173— MS. Wilson 312
Bhuvanesvaristotra, A. D. 1709.
Contents: see Weber, Catal., II, 349-351 (an
abbreviated commentary); Burnell, Tanjore catal.,
p. 200; Peterson, Report, 1882, 1883, p. 117, Report,
1883, 1884, App., p. 13 ; Aufrecht, Flor. catal., no. 89,
Leipzig catal., pp. 459, 460.
The text is bounded on either side by two red lines.
Measurement of binding : 10^x5 in.
No. of leaves: i + 83 + i blank.
Scribe: f. 83: idarn pustakam Sarasvatldipikdydm
Rrahmadevaabhirena (sic) likhitam svdrtham parartha
cet l
SANSKRIT MSS.
174-ms. Ouseley 413
Devikavaea, &c., 19th cent.?
Contents: for these pieces see MS. Sansk. d. 60 (1474).
The Argalastotra has only twenty-three verses, ending:
idam stotram pathitva ta mahdstotram pathen narah \
sa tu saptasatisamkhyam varam dpnoti sampadah 11 23 11
ity Argalastotram 1 The writing is beautifully clear.
Cf. Eggeling, India Office catal., p. 1285; Aufrecht,
Leipzig catal., p. 89, where it is called an extract from
the Variiha Purana. _
Former shelfmark: MS. Ouseley 714, now MS.
Ouseley 413.
Kept in a box.
Ornamentation: there arc very well drawn pictures
of Devi and of fiowers.
175, 176— MSS. Walker 155, 156
Raghuvamsa, 18th cent.?
Contents : Kiilidiisa’s date is fixed between about
a. d. 350 and 450 by the Mandasor Inscription of
Kumaragupta’s reign (a. d. 472), cf. Biihler, Die
indisclien Inschriften, p. 71, on the one hand, and the
astronomical date from the epics in Jacobi, Monatsber.
der Berl. Acad., 1873, P* 55^» on the other. Against
this positive evidence the Renaissance theory (cf. Huth,
Die Zeit des Kalidasa, 1890) breaks down, Macdonell,
Sansk. Lit., ch. XI. This epic is later than the Kuma-
rasambhava according to Jacobi, Die Epen Kulidasa’s,
p. 155 ; cf. however Schmidt, Beitrage z. indischen
Erotik, I, 4, 5. Schroeder, Vienna Orient. Journ ., XV,
301, refuses to accept Kielhorn’s date, and Hoernle
regards him as a contemporary of Yasodharman
Vikramaditya (a. d. 533-575). See also J.R.A.S.,
1904, pp. 158, 396.
The text occupies the centre of each page, the
commentary the top and bottom. In 155, ff. 99, 100,
121—128 are bounded on either side by three red lines.
Measurement of binding : 1 ii x 6^ in. approximately
for both volumes.
No. of leaves : 155 = ii + 204 + ii blank; 156 = ii +
236 + iii blank. The nineteen sargas are separately
foliated by the original hand, having 32 + 26 + 24+24 +
25 + 27+19 + 26 + 27 + 22 + 25 + 23 + 22 + 21 + 20+23
+ 19 + 16 + 19 leaves. In the new'foliation 155 has no
•f. 136.
177— MS. Walker 182 °
Raghuvamsa, A. D. 1589.
Contents: the text is bounded on either side by
a broad red line over two narrow ones. In the centre
APPENDIX TO VOL. I ( 169 - 183 )
23
of each page is the usual empty space of the Jaina
MSS., partially filled by red diagrams, and on the verso
of some leaves, or recto of others, are two red spots
in the margin. There are many corrections and glosses.
Character: Jaina Devanagari.
178— MS. Mill 95
Raghuvamsa, A.D. 1823.
Contents: the sargas end on ff. 5, 9, i3 v , I7 V , 22,
26V, 3o v , 35V 4 o v , 43 v , 48, 5 6v > 6iV , 66 > 7°i 74>
77, 80. F. 80 contains a list of the chiefs mentioned.
The text is bounded on either side by two red lines.
The gramthasamkhya is given as 2000.
Measurement of binding : 9^ x 6-| in.
No. of leaves : i + 80 + i blank. Style of European
books.
Date: f. 80 : samvat 1879 (= a. d. 1823) varse caitra-
krsna 30 budhavdsareh \
179— MS. Wilson 235«
Raghuvamsa, 19th cent.?
Measurement of binding : 147 X 5! in.
Material: yellow country paper.
No. of leaves: ii +219+ ii blank. The original
foliation has 111 + 108 leaves.
Date: how the Bodl. catal. distinguishes between
the dates of this part and of 202 is not clear.
Scribe: both parts are apparently written by the
same scribe.
180, 181— MSS. Walker 185, 186
Mallinatha on the Raghuvamsa, 16th and
18th centuries?
Contents: these MSS. are of some interest as con¬
firming the date assigned to Mallinatha on the strength
of the reference in Ballala’s Bhojaprabandha (about
a. d. 1600, Bodl. catal., p. 150k). The MSS. which must
be dated about a. d. 1550 show lacunae, and evidently
are not directly derived from the author’s original.
This disproves the attempt to put his date after
a. d. 1660,—made in the preface of the Nirnaya
Sagara edition of the Kiratarjunlya, p. 2. On the other
hand, the fact that he composed a commentary on the
Ekavall (about a. d. 1300), in which , he says it had
become neglected, proves that he cannot be earlier than
a.d. I 35°* Probably a.d. 1400-1500 are the limits.
Cf. Bhandarkar, Report , 1887-1891, p. lxix. Malli-
natha’s son Kumarasvamin in his commentary on
Vidyanatha’s Prataparudriya mentions Pratapa’s acces¬
sion, a. d. 1295, as P U) 'a kilci, see Pischel, Prakrit
Grammar, p. 42.
The text is bounded on either side by two double
red lines.
Measurement of binding : 10 x 5 in. approximately for
both volumes.
No. of leaves:
185 = ii +122 +ii blank. The original foliation
has 137, but ff. 72-86 are lost.
186 = ii + 136 + ii blank. Originally foliated as
i 3 8 “273-
Character: Devanagari, with some Jaina charac¬
teristics.
182— MS. Wilson 529
Mallinatha on the Raghuvamsa, 18th cent. ?
Contents: the text is bounded on either side by
two double red lines.
Measurement of binding: 11| x 5^ in.
No. of leaves : xii + 103 + xii blank. By the original
hand the chapters are foliated severally, having 15
(really 5, as ff. 1-10 are lost) + 16+ 14+ 13+ 13+ 13 +
8 +10 + 11 leaves.
Date : perhaps 18th century, to judge from the fresh
appearance of the paper.
183— MS. Walker 210«
Mallinatha on the Raghuvamsa, A. D. 1622.
Contents: ff. 104—126 are by one hand. They are
numbered as ff. 56-66, 73-84. The text is bounded
on either side by two black lines. Ff. 127—132 are by
one hand, text bounded by two red lines. Ff. 133-141
apparently by one hand, text bounded by two black
lines, numbered as ff. 69-77. Ff. 143-164 by one
hand, ff. j64 v -i7I v by another, numbered consecutively
as ff. 112-141, f. 128 being lost. The text is bounded
by two black lines.
Best recent editions, by M. R. Kale (with transla¬
tion), Bombay, 1897; Gopal Raghunath Nandargikar,
Poona, 1897, with extracts from eight other com¬
mentaries ; in the Nirnaya Sagara press, 1898 ; text
(with translation), by Jvalaprasad, Bombay, 1895.
Measurement, fyc.: this is part 3 of the MS. described
under 203.
Date: on f. i7i v is given the date of ff. 164^17i v :
samvat 1678 ( = a. d. 1622) varse dsadha (mdse krsna-
pakse 2 some adyeha : these words and all that follow
have been damaged by the tearing of the foot of the
page. The restoration here proposed is only probable) l
24
CATALOGUE OF
184—MS. Min 44
Kumarasambhava, A. D. 1827.
Contents: edited with various readings, and the
commentary of Mallinatha on Books I—VIII, and that
of Sltarilma on VIII-XVII, by Niirayanabhatta Parva-
nlkara and Kasinatha P. Parab, Nirnaya Sagara press 3 ,
Bombay, 1893 . Also at Bombay in 1898 (with three
commentaries); translation by Griffith, London, 1879*
The text is placed in the centre, the commentary
at the top and bottom of each page.
Measurement of binding : 12 f X 6 j in.
No. of leaves : ii + 67 + i blank.
Date : f. 67 : savata 1883 ( = a. d. 1827 ) miti bhddra-
sudi 5 1
185 —MS. Mill 97 !
Kumarasambhava, 19th cent.?
Contents : according to a note, unfortunately partly
illegible, on f. 37, this copy was made by or for
Samkaradeva from a MS. which had forty-nine leaves,
but was worn out. The text, which is occasionally
corrected, is bounded on either side by two black lines.
Measurement of binding : 8^- X 5 in.
No. of leaves : ii + 37 + ii blank.
186— MS. Walker 200^
Kumarasambhava, A. D. 1774
Contents: the text is bounded on either side by
three red lines.
Measurement of binding : 11 X 6| in.
No. of leaves : ii +239+ ii blank. The seven parts
have 35 + (5 + 12)+ 35+ 28+ 34+ 12 + 76 leaves.
Date: f. 87 : samvat 1830 ( = a.d. 1774) asd(lhavadi
8 somavdsare 1
Scribe: f. 87: agnihotrivydsatnlasi tasyatmajena
Bhvdevandmnd vilikhitam asti I Cf. 605. Usual style
of this scribe’s MSS.
187— MS. Wilson 39 d
Kumarasambhava, 19th cent.?
Contents: the verses are numbered from f. 160 onwards.
Measurement, fyc.: this is part 4 of the MS. described
under 338. *
188- MS. Walker 201°
Kumarasambhava, 17th cent.?
Contents: the text is bounded on either side by
SANSKRIT MSS.
two red lines. It is very carelessly written, and a good
deal corrected.
Measurement, fyc.: this is part 3 of the MS. described
under 610.
189— MS. MiU 10
Kumarasambhava, 19th cent.?
Contents: f. 26 V is blank, but nothing is missing.
Measurement of binding : I5f X 3J in.
Material: yellow country paper.
No. of leaves : i + 29 + i blank.
190 —MS. Mill 28
Kumarasambhava, 19th cent.?
Contents: it appears that these sargas cannot be
Kalidasa’s, as the language shows traces of vernacular
influence in sargas IX—XVII, Jacobi, $th Or. Congr.
(Berlin, 1882), II, 2, 145 sq. Sarga VIII is however
quoted by Anandavardhana as the work of a mahakavi,
and though hardly Kalidasa’s (Gdtt. Gelehrte Anz.,
1874, p. 873) is ancient, Pischel, Budrata, p. 24.
Measurement of binding : 14-j x 4^ in.
Material: yellow country paper.
No. of leaves: i + 42 + i blank.
Scribe: doubtless by the same hand (cf. spacing of
words) as 320.
191— MS. MU1 45
Kumarasambhava, A. D. 1834.
Contents: the sargas end on ff. 5, 7 V , 9 V , n v , 14,
i6 v , i8 v , 2i v , 23, 26. The scribe has marked lacunae
wherever he could not read the Bengali.
Measurement of binding: 12 j x 6 * in.
No. of leaves : ii + 26 + ii blank.
Date: on f. 26 was originally written : hisamvat
1884(f) asddhasuklapaksasya astamyam (some ten
aksaras illegible) Sumbhundthakasmlri 1 A later hand has
obliterated the month, &c. with yellow pigment, changed
the year 1884(f) into 1890 («= a. d. 1834) and the month
to pusasuklapaksa 5 vdrabuddhavare samaptam 1
192— MS. Walker 138
Ghantapatha, 17th and 18th centuries?
Contents: best edition, in the Nirnaya Sagara press,
third edition, 1895. Bharavi’s date cf. Jacobi,
Vienna Orient. Journ., Ill, 121 sq., who seeks to show
that he is earlier than Magha, Subandhu, Bana, and
therefore before a. d. 550. As he is doubtless later
than Kalidasa, he is probably not earlier than a. d. 400.
25
APPENDIX TO
He is quoted by Raviklrti (a. d. 609), Ind. Ant., VIII,
243 sq.
The four hands may be thus distinguished: (1)
ff. 1-13, 16-43; ( 2 > 3) ff* 44-109, irregularly divided
between two hands; (4) ff. 110-135. The text is
bounded on either side by two red or two black lines.
Many corrections have been made in the older parts.
Measurement of binding : 9^ X 5! in.
No. of leaves : ii + 135 + ii blank.
193_MS. Mill 73
S'i£upalavadha, A. D. 1672.
Contents : Magha is quoted by Anandavardhana
(a.d. 850), by Vamana (probably a.d. 800), and imitated
by Ratnakara (a.d. 835-847), Jacobi, Vienna Or.
Journ., IV, 244, who, ibid., Ill, 142, 143, tries to prove
that he is imitated by Subandhu. The only serious
argument against this is that urged by Levi, Theatre
ind., App., p. 40, who thinks that S'isupfdavadha, XX,
44, alludes to the Nagananda. But probably it refers
to an earlier na(aka which was utilized by the author
of the Nagananda; cf. also on MS. Sansk. b. 2 ( 1236 ).
The text is bounded on either side by three red
lines. Very inaccurate in the new part.
Measurement of binding : io| x 4^ in.
No. of leaves : i + 123 + i blank.
Cate: f. 123: subhastu samvat 1728 ( — a.d. 1672)
asadhasudi trodasyayam ravivdra subham l yat drsta
likhitam maya bhramadosam ksama prabho l This is
probably the date of the old-part or of the exemplar.
The new part belongs to the end of the 18th century.
A former owner was Visnubhatta, ff. 1, 124 V : Md-
ghakavyapustakam idain Srimadvisnubhattandm \ He
must have been the owner from whom Mill obtained it.
194— MS. Wilson 174
S'isupalavadha, 19th cent.?
Contents : the MS. is rather inaccurate.
Best edition, Durgaprasada and S'ivadatta, Nirnaya
Sagara press, Bombay, 1890.
Measurement of binding : i6-| X 4J in.
Material : yellow country paper.
No. of leaves : ii + 92 + ii blank.
195— MS. Walker 162 ^
S'iiupalavadha, 18th cent.?
Contents : the text is bounded on either side by
two black lines. - ■
Measurement, fyc.: this is part 2 of the MS. described
under 207 .
VOL. I (184-200)
196,197 —MSS. Wilson 494, 495
Sarvamkasa, 18th cent.P
Contents: the MS. is not very accurate, and there
are a good many lacunae.
Measurement of binding : iof x 6f in. approximately
for both volumes.
No. of leaves : 494 = iii +279+ ii blank ; 495 = iii +
239 + ii blank. In 495 there is no continuous original
foliation.
198— MS. Wilson 326
Subodha, 19th cent. P
Contents : Bharatamallika lived as client of Kalyana-
malla about the end of the 18t.h cent., Aufrecht, Catalogus
Catalogorum, p. 396. Cf. Mitra, Notices, IX, 251.
Measurement of binding : 13I X 6^- in.
Material: yellow and grey country paper.
No. of leaves : ii + 197 + ii blank.
199— MS. Wilson 38
Subodha, 19th cent.P
Contents : the number of slokas is given as 6,500
on f. 1. The MS. is fairly accurate. The verses are
numbered in sargas XIV (88) and XV (95).
Measurement of binding : 17 x 7 in.
Material: yellow country paper.
No. of leaves: ii + 171 + ii blank. The original foliation
makes only 170, a 'blank leaf after f. 21 being counted
in the new reckoning.
200— MS. Wilson 498
Naisadhlyacarita, A.D. 1734.
Contents: Harsa, the author of the Khandana-
khandakhadya, flourished under Jayaccandra of Kanauj
(who began to reign between a. d. 1163-1177), Journ.
Bomb. Br. B.A.S., X, 31, XI, 279 ; Gough, Records
of Anc. Sansk. Lit., p. 130. Edited, with Mallinatha’s
commentary, by Jivananda Vidyasagara, Calcutta,
1:875— 1 876; by S'ivadatta, Nirnaya Sagara press, 1894.
The text is bounded on either side by two red lines.
Measurement of binding : 9^ x 5J in.
No. of leaves: ii+287 + ii blank. The original
foliation makes 315, but ff. 1-4,15-38 are lost.
Cate: f. 287V: knmadvikramabhupateh sakagane
khdmkagaprthviyute 1790 ( = a.d. i 734) jyesthasyarjuna-
paksa visvasutithau yate ravau tvastrbhe \ Not 1736 as
in the Bodl. catal.
80DL. SANS. CATAL. APP.
20
CATALOGUE OF SANSKRIT MSS.
Scribe : f. 28 ; v : kavyarn ramyam alllikhad dcijakula-
la mka rakdsisvarah 11149 II Somanopakandmnd vai Kdsi-
nuthena dhimata \ likhitam Naisadham kdivyam Viyhnesa-
sya prasddatah 11150II subham svdrtham pardrtham \
201— MS. Wilson 170 e
Naisadhiyacarita, 19th cent. ?
Measurement, $c.: this is part 3 of the MS. described
under 217.
202— MS. Wilson 235 b
Naisadhiyacarita, 19th cent.?
Measurement, Sfc.: this is part 2 of the MS. described
under 179.
203— MS. Walker 210*
Naisadhiyacarita, 17th and 18th cent. ?
Contents: perhaps three main hands only need be
distinguished: (1) if. 1—60; (2) If. 61—66; (3) ff. 67—
78. Ff. 13-18 are, however, written by two or three
other hands.
The text is bounded on either side by two red or two
black lines. There are a good many later corrections.
Measurement of binding : io| X 6|- in.
No. of leares : ii + 171 +ii blank. The three parts
have 68 + 23 + 78 leaves. The original foliation of parts
2 and 3 is hopelessly confused.
Scribe: there is a note on f. 78 v which applies only
to the third hand : Amgandbhidhapure nivasan srigauda-
jdtir abhivamdya mahesam 1 cha 1 Burlabhah kavipadam-
bujapamsur Naisadhiyam alikha chubhasargam II
204, 205— MSS. Wilson 348, 347
Narayana on the Naisadhiyacarita,
A. D. 1813 and 1821.
Contents: Ramacandra Sesa was Nar ay ana’s son
and pupil. Presumably the commentary was written
by him from his master’s teaching, and then, as often,
ascribed to his master.
Four hands can be distinguished: (1) 340, ff. 1-7 ;
(2) 340, ff. 8-280, 347, ff. 1-118 ; (3) 347, ff. 119-186 ;
(4) 347 j ff* 187-239. There are many later corrections.
Measurement of binding : 13 x 6-j in.
No. of leaves:
346 = ii + 280 + ii blank. In the original foliation
there are 7 (numbered 11—17)4-244-344-52 + 23 + 25
(really 26, f. 3 being doubled)+115 (really 114, f. 23
being lost) leaves.
347 = ii 4- 239 + ii blank. In the original foliation
119 (really 118, as there is no f. iii) + 69 (really 68,
as there is no f. 64) 4- 53 leaves.
Bate:
.(1) 348, f. i40 v : sanwat 1869 (= a. d. 1813) I This
is added by a later hand, but is probable enough. It
applies to the second hand.
(2) 347, f. 186: samvat 1877 ( = A. D. 1821) dsd-
dhamdse suklapakse trayodasyam 13 suryavdsare \
This applies to the third hand only. The first hand
is probably to be dated about a.d. 1780; the fourth
about 1820.
Scribe: 347, f. 186: likhitam brahmamharaldla
Kdsimadhye 1 Applies to the third hand only.
206— MS. Wilson 241
Ramacandra Sesa on the Naisadhiyacarita, 18thcent.?
Contents: the commentary of Ramacandra bears
the title Bhavadyotanika, and the author was son of
Narayana, see Bhandarkar, Report , 1883, 1884, p. 16.
The commentary on sarga XVII, graintha 1650, 122
verses, ends on f. 32. The commentary on sarga XIX,
gramtha 980, 68 verses, ends on f. 49. That on sarga
XX, 63 verses, ends on f. 67 v . From f. 3 V the text is
bounded on either side by two double red lines ; ff. 1,
2 are possibly a later restoration. A lacuna is marked
on f. 63 v . ——
Measurement of binding : 13! X in.
No. of leaves: ii + 67 + ii blank. Foliated originally
i as three parts with 32+17+18 leaves.
Injuries: the MS. is a good deal damaged by water,
especially part 3.
207— MS. Walker 102*
Narayana on the Naisadhiyacarita, 18th cent.?
Contents :■ the text is bounded on either side by
two red or black lines. It is careless and inaccurate.
Measurement of binding: 11+ x 5^ in.
No. of leaves: ii + 153 + ii blank. The five parts have
(14 + 9+ 49)+ 6 (numbered 87-93, omitting 92)+ 29 +
12 + 31 leaves.
Bate: the oldest part is probably not earlier than
the beginning of the 18th century.
208— MS. Walker 190*
Damayantikatha, A.D. 1442.
Contents : see on MS. Sansk. d. 70 (1243). Edited,
with commentary, in the Nirnaya Sagara press, 1885.
The text is bounded on either side by two black
or red lines, smeared over with red. The writing
is in two slightly different styles.
Measurement of binding : 9^ X 5^ in.
APPENDIX TO VOL. I (200-214)
27
No. of leaves: ii + 144 + ii blank. The three parts
in the original foliation have 118 + 154-9 leaves.
209—MS. Walker 208 a
Damayantikatha, 15th cent.?
Contents: the text is bounded on either side by a red
line between two double black lines. In the centre
of each page is the usual Jaina diagram, partially filled
in with red on ff. 1, 57 v . F. 1 is evidently a later
restoration. Glosses have been written in. The
chapters end on if. 7 V , I3 V , 2o v , 26 v , 38, 47 v , 57'',
with 61, 38, 34, 27, 77, 74, 45 (■) verses.
Measurement of binding : io| X 6 in.
No. of leaves : ii+ 139 -h ii blank. The five parts in
the original foliation have 58 (57, as f. 2 is lost) + 7 +
24 + 12 + 35 leaves.
Bate: either not given or lost, but certainly as old
as the 16th, and probably the 15th century.
Scribe: f. 57 v : Tapapakse snsomasumdarasisya-
mukhyapamditasirovatamsapujyarddhyapam o (4 aksaras
deleted by a later hand) ganisisyena (4 aksaras deleted)
munikrte likhito 9 yam gr amt hah snmati Ahammadavd-
danagare I As Somasundara was s\xri in a. d. 1400,
a sisya of his sisya would have lived about a. d. 1450
at latest.
Character: Jaina Devanagarl.
Injuries: there is a hole in f. 56 and the foot of f. 57
is tom away.
210 —MS. Wilson 245 a
Damayantikatha, A. D. 1821.
Contents: the MS. has occasionally been corrected
by a later hand. F. 45 is by a different and older
hand. The chapters end on ff. 15V, 27, 39, 49 v , 71,
87V, 104. They contain 63, 37, 29, 28, 77, 42 verses,
the number in chapter 5 not being noted beyond 50.
Measurement of binding : 14 x 7 in.
No. of leaves: ii + 259 (really 260, as f. 102 is
double) + ii blank. Originally foliated as three parts,
having 104 (really 105, but f. 1 is blank)+ 43+ 112 leaves.
Bate: f. 104: miti sravanakrsnapaksa 13 samv 0 1871
( 5=3 A. D. I821) I
211— MS. Walker 129 c
Draupadivastr&harana, A. D. 1780.
Contents: perhaps this is Govardhana’s work, cf.
Aufrecht, Catalogus Catalogorum , p. 264. The text
is bounded on either side by two red lines. The scribe
has added some devotional verses.
Measurement, Sfc.: this is part 3 of the MS. described
under 98.
Bate: f. 174: samvat 1836 ( = a. d. 1780) asadha-
vada 11 bhrgau li° I
Scribe: f. 174: agnihotritulasibhudevapa 0 1 Usual
style of this scribe’s MSS.
212— MS. Wilson 39^
Raghavapandavlya, 19th cent. ?
Contents: Kaviraja’s date is somewhat uncertain.
It is probable that he was imitated by Srutakirti-
traividya or Dhanamjaya in his Raghavapandavlya
(about a. d. 1130, see Bhandarkar, Report, 1884-1887,
p. 20; Pathak, Ind. Ant., XIV, 14; Zachariae, Bie
indisch. Worterbiicher, p. 28). On the other hand it
is just possible to regard him as the ancestor of
Rajasekhara ( Z.B.M.G., XXVII, 77), and to put even
Dhanamjaya (not then to be identified with Srutakirti)
before Rajasekhara, see Peterson, Report, 1883, 1884,
p. 59, verse 7. In that case the name Munja must be
explained, and possibly Munja of Dhar adopted it as
being the name of a famous predecessor. Cf. Pischel,
Rudrata, p. 25. Or the verse may be spurious. That
Rajasekhara is the poet is very probable, cf. Keith,
J.R.A.S., 1901, p. 579.
Edited, with commentary, in Kavyamala, no. 62.
Measurement, fyc.: this is part 2 of the MS. described
under 338.
213— MS. Walker 181 b
Ramacandracaritrasara, A.D. 1702.
Contents: the text, written in a cursive hand, is
bounded on either side by two black lines.
Measurement, fyc.: this is part 2 of MS. Walker 181
(119).
Bate: f. y8 y : samvata 1758 ( = a. d. 1702) varse
vaisdsasudi 7 guruvasare pathandrtham lasitam l Possi¬
bly this may be the date of composition also.
214— MS. Wilson 493?
S'ankaracetovilasa, 18th cent.?
Contents: the MS. seems too modern and too
inaccurate to be an autograph. The text is bounded
on either side by three red lines. For Sankara cf.
285. _
Measurement, §c.: this is part 7 of the MS. described
under 507.
E 2
28
CATALOGUE OF
215, 216— MSS. Walker 128, 127
S'arhgadharapaddhati, 18th cent.?
Contents: the work is analysed by Aufrecht,
Z.D.M.G., XXVII. Edited by Peterson, vol. I,
text, Bombay, 1889. Lithographed at Benares in 1875.
Composed in a. d. 1363, Hall, Intr. to Vdsavadattd,
Aufrecht, /. c.
The text is bounded on either side by two or three
red lines. —
Measurement, of binding: lof X5J in. approximately
for both volumes.
No. of leaves: 128 = ii + 240 + ii blank ; 127 = ii +
198+ ii blank. The original foliation makes 472, but
ff. 2c6, 222, 224, 225, 288-310, 321-327 are missing
and f. 123 is double.
217— MS. Wilson 170 a
Rtusamhara, 19th cent. ?
Contents: edited, with Manirama’s commentary,
Nirnaya Sagara press, 1885; with notes and English
translation, Bombay, 1897. It is probably a work of
Kfdidasa (though e. g. Levi rejects it), because it is
copied in the inscription of a. d. 472 at Mandasor
(Corp. Insc. Ind., Ill, 81 sq.; Buhler, Die indischen
Jnschriften mid das Alter dev indischen Kunstpoesie ,
p. 71), which also copies the Meghaduta, and we can
hardly assume an anonymous mahakavi. Besides, the
style and manner are entirely those of Kalidasa.
Measurement of binding: 14^ X 5^ in.
Material: yellow country paper.
No. of leaves : ii + 121 + ii blank. The three parts
in the original foliation have 14+26 + 81 leaves. The
last two parts are numbered consecutively.
Scribe: the same hand wrote 201, 217, 224.
218— MS. Wilson 307
Meghaduta, 19th cent.?
Contents : the best critical edition is that of Stenzler,
Breslau, 1874. Extracts from these six commentaries are
printed in V. S. Islampurkar’s edition, Bombay, 1889.
Translated, &c., by Pathak, Poona, 1894; Nandar-
gikar, Bombay, 1894. Pathak’s discoveries are most
valuable for the constitution of the text. Kalyanamalla
was patron of Bharatasena (18th cent.), Mitra, Cat.
Gramm. MSS., p. 23, Notices, VI, 145, VII, 148, 149.
The others are all no doubt later than Mallinatha.
Can llamanatha be identical with Ramanatha Vidya-
vacaspati who wrote an Abhijfianasakuntalatika and
lived about a. d. 1623-1633, Aufrecht, Catalogus
SANSKRIT MSS.
Catalogorum, p. 516? Both are Saiva’s according
to their prefaces. See also Pathak’s preface.
Written before the Kumarasambhava according to
J.B.A.S., 1903, p. 186. The date of Kalidasa there
given (a. d. 450-475), cf. on 176, 178, cannot be
accepted, cf. Liebich, Das Datum Candragomin's und
Kalidasa's, Breslau, 1903, and J.R.A.S., 1901, p. 579,
1904, pp. 166 sq.
Measurement of binding : 11-| X 9-j in.
Material: paper water-marked ‘ J. Whatman.’
No. of leaves : ii + 134 + ii blank. Arranged like
a European book.
Date : the latest date in the water-mark seems to be
1805.
219— MS. Walker 128 0
Nalodaya, A. D. 1694.
Contents: the most probable author is Ravideva,
son of Narayana, whose name occurs in various MSS.,
Bhandarkar, Report , 1883, 1884, p. 16 ; Peterson,
Report , 1884—1886, pp. 20, 334. The text has often
been printed. Translated by Yates, Calcutta, 1844.
DevTprasada, Oudh catal., XX, 52, mentions a com¬
mentary by Ravideva, which further confuses matters.
The text is bounded on either side by two red lines,
and has been a good deal corrected by a later hand.
Measurement , Sfc.: this is part 3 of the MS. described
under 786. *
Date: f. 84V: svasti samvata 1650 ( = a.d. 1594)
varse bhadrapadasudi 3 sanau \
Scribe: f. 84 v : srigurutilakiyabhutasaddcdrasuddha-
sakalavidydvisdradasakalagundlamkrtabhattasriharamjit
svayam evavalokanaya ca putrddindm pathandrthdya
idam llkhapitam l
220— MS. Walker 171
Nalodaya, A.D. 1613.
Contents: the text is bounded on either side by
two red lines, which do not extend to the top of the
page as usual. —
Measurement of binding : 12| x 6-j in.
No. of leaves : ii + 144 + ii blank. In the original
foliation the two parts have 20+123 leaves.
Date: f. 20: samvat 1670 varse sake 1535 ( = a.d.
r6i3) pravarttamane margaslrsamase suklapakse dviti-
yayam tithau bhrguvdsare l
221— MS. Mill 72
Gitagovinda, 19th cent.?
Contents: Jayadeva was son of Bhojadeva, of
Kinduvilva in Bengal. Pischel, Hofdichter des Laksma -
APPENDIX TO VOL. I (215-229)
29
nasena, p. 30, has attempted to prove that the poem
goes back to an original in Apabhramsa Prakrit. Cf.
his Prakrit Grammar, p. 34. Probably the author
flourished under Laksmanasena, founder of an era
(a. d. 1119 V), Biihler, Kasmir Report, p. 64; Pischel,
Gott: Gelehrte Anz., 1883, p. 1222 ; Epigr.Ind., I, 305,
306; Z.D.M.G., XL, 142; Peterson, Subhasitavali,
p. 38. Edited by Jivananda Yidyasagara, Calcutta,
1882; by Harimohana Yidyabhusana, with Caitanya-
dasa’s commentary, Calcutta, 1887; with Narayana’s
commentary, Bombay, 1885; with Kumbhakarnama-
' hendra’s and Sankaramisra’s commentaries, Nirnaya
1 Sagara press, 1899. Translated into German verse by
I Riickert, Abhdl. f. d. Kunde d. Morgenl., vol. I; into
> English verse by Sir E. Arnold, Indian Poetry, 1881,
pp. 1-97.
The text occupies the centre, the commentary the
1 top and bottom, of each page.
Bhandarkar, Report, 1887-1891, pp. lxxxvi sq., has
recently shown some evidence for Laksmanasena’s date
being a. d. 1172, a very important conclusion.
Measurement of binding : 11 X 5-j in.
No. of leaves: i + 95 + ii blank.
222— MS. Wilson 337°
Gitagovinda, A. D. 1761.
Contents: the text occupies the centre, the com¬
mentary the top and bottom, of each page. The whole
is bounded on either side by two double red lines.
There are a few corrections by a later hand.
Measurement, Sfc.: this is part 3 of the MS. described
under 667 .
Date: f. 48: samvat 1817 ( = a.d. 1761) 'saimai nama
phalgunl \
223— MS. Mill 2b
Gitagovinda, 19th cent. P
Contents: possibly there may be some connexion
between this and the work described by Mitra, Notices,
II, 319; Aufrecht, Leipzig catal., p. 131.
The text occupies the centre, the commentary the
top and bottom* of each page. The commentary is
written in a pale-coloured ink, apparently by the first
hand. _
Measurement, fyc.: this is part 2 of the MS. described
under 170 .
224— MS. Wilson 170 b
Gitagovinda, 19th cent. P
Measurement, Sfc.: this is part 2 of the MS. described
under 217 .
225— MS. Walker 162<1
Gitagovinda, A.D. 1794.
Contents : the page is divided into two parts by two
red lines down the centre. In the right hand column
nothing is written, in the left is the text. On the recto
it is upside down.
Measurement, fyc.: this is ff. 1-30 of part 4 of the
MS. described under 246.
Date: f. 273: samvat 1850 ( = a.d. 1794) nd varse
sravanavada 10 ravau 1
Scribe: f. 273: lasavitam rihisnavamatdsri 5 jdmnakl (?)
Haribhaktir astu \ Cf. 227 (where the same patroness
appears) and 242.
226— MS. Wilson 493°
Anandalaharistotra, 19th cent.?
Contents: printed in Brhatstotraratnakara, p. 179.
The text is bounded on either side by two red lines.
Measurement, Sfc.: this is part 3 of the MS. described
under 607.
227— MS. Walker 1520
Alamandarastotra, A.D. 1794.
Contents: the author was Yamunacarya, Hall,
Bibliog.Index, p. 117; Aufrecht, Catalogus Catalogorum,
p. 54 ; Leipzig catal., p. 240.
The MS. is written in the same style as 225.
Measurement , fyc.: this is ff. 32—43 of part 4 of the
MS. described under 246.
Scribe: f. 285: pathanartham mutdjdmnaki 1 See 225.
228— MS. Walker 162©
Kalyanarajaprasasti, 17th cent.?
Contents : Gokulajit wrote his Samksepatithinirna-
yasara in a.d. 1632 for Kalyana of Iladurga in Gujarat,
Weber, Catal., I, 332.
The text is bounded on either side by two black
lines. Yellow pigment is used for corrections.
Measurement, fyc. : this is part 5 of the MS. described
under 207.
229 — MS. Wilson 245 b
KaSikatilaka, A.D. 1821.
Contents: the MS. is written in a very confused
way, but as a rule the text occupies the centre, the
commentary the top and bottom, of each page.
Measurement, fyc.: this is part 2 of the MS. described
under 210.
30
CATALOGUE OF
Date: f. 147: samvat 1877 (a. d. 1821) asvinamdse
krsnapaksa avasa 301
Scribe: f. 147: likhitam Kasinat hade sav all I mdna-
mamdira \
230— MS. Wilson 242 a
Krsnakarnamrta, 19th cent.?
Contents: for the text see also the fragment in
MS. Sansk. d. 72 (1095), which is a much larger work.
The commentary is in all probability by Vrndavanadasa,
see Mitra, Notices, IX, 63, since verses 2 and 4 in
Mitra occur as verses 1 and 2 here.
The text is in the centre, the commentary at top
and bottom, of the page.
Measurement of binding: 13^x6 in.
Material: yellow country paper.
No. of leaves: ii + 72 + ii blank. The three parts
have 16 + 26 + 31 (really 30, as f. 1 is missing) leaves.
Scribe: all three parts are by different hands.
231— MS. Wilson 242 b
Sarangarangada, 18th cent.?
Measurement , SfC. : this is part 2 of the MS. described
under 230.
Material: grey country paper.
232— MS. Walker 200*
Khandaprasasti, A. D. 1778.
Contents : see on MS. Sansk. d. 67* (1240).
The text is bounded on either side by three red lines.
Measurement, fyc.: this is part 4 of the MS. described
under 186.
Date : f. ii5 v : samvat 1832 ( = a. d. iyj6)maghasudi
12 gurau I
Scribe: f. 115 v : agnihotrivyasatulatatsutenaBhudeva-
ndmnd likhitd Kharndaprasastih\ svartheparopakarurthe I
233— MS. Walker 192*
Gitagangadhara, 17th cent.?
Contents: the text is bounded on either side by
a black line.
Measurement, fyc.: this is part 4 of the MS. described
under 792.
Date: f. no: paridhdvisamvatsara \ bhadrapadavu-
dyapratipadd Gamgadharagramtham sampurnam \ By
the Brhaspati cycle this is probably a. d, 1781, 1782.
Cf. on 241.
Scribe: Ivesava also wrote part 2.
SANSKRIT MSS.
234— MS. Wilson 420?
Gitagirisa, A. D. 1787.
Contents: the text is bounded on either side by two
double black lines. Ff. 49, 51, 53, 55, 57, 59, 61, 63 are
on yellow paper. Various corrections have been made
by a later hand.
Measurement , 8fC. : this is part 6 of the MS. described
under 551.
Date: f. 64: the colophon continues vaisdkhamdse
krsnapakse l somadine likhi 1
235— MS. Wilson 328 a
Gunaratnakosastotra, 19th cent. ?
Contents: the commentator is probably the author
of the words at the end of the colophon : sriramdnvjdya
namah, and he may well be the writer of the various
works mentioned by Aufrecht, Catalogus Catalogorum ,
p. 608b.
The text is bounded on either side by two dark red
lines. ■ -
Measurement of binding : 13^ X 6£ in.
No. of leaves : ii+ 114 + ii blank. The three parts
in the original foliation have 22 + 83 + 9 leaves.
236— MS. Wilson 230
Bhaminivilasa, A.D. 1815.
Contents: printed at Bombay in 1884 (text only);
edited by K. P. Parab and M. R. Tclang, Bombay,
1894; by Seshadri, Bombay, 1894; and with a transla¬
tion by Bergaigne, Paris, 1872; some brief specimens
of the commentary are given in V. Henry’s Trent e Stances
du Dhamini-Vilasa, Lille, 1885. On f. 1 is a title-page
by II. II. Wilson. Cf. MS. Sansk. d. 73 (1200).
Measurement of binding : 14x10^ in.
No. of leaves: iii+114 +iii blank. Originally 113,
but a blank leaf (f. 62) is inserted. Leaves arranged as
in a European book.
Date: f. 1 : ‘ Copied from a MS. belonging to
Mr. Colebrooke and partially translated by him.
II. H.W. 1815.’
237— MS. Walker 129*>
Mahimnahstava, A.D. 1778.
Contents: the work is known to the Kedarakalpa,
Aufrecht, Leipzig catal., p. 117. Cf. MSS. Sansk. 74,
75 (1262,1263). Madhusudana Sarasvati and S'rldha-
rasvamin interpret the poem as referring to both Hari
and S'iva (Mitra, Notices, VII, 152). Ahobala’s com¬
mentary begins with a verse written by a later hand,
for which however the original hand had left space:
31
APPENDIX TO
i sdnah sarvavidyanam isvaram Parvatipatim i bhajami
mmahadevam sarvavedottamam prabhum mu
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 2 of the MS. described
under 08.
Bate: f. 165: samvat astadasasatadvatrimsatame l
sake sodasaptamkarmne(i ) sravanamdse suklapakse pam-
camyam kvje dine I
Scribe: f. 165: vyalikhat avaitanopdsanavydsatula-
sicirajivisnbhudeva pathanartham I sri I
238—MS. Walker 205 0
Rajanitiiastra, A. D. 1737.
Contents: see Weber, Catal., II, 171, and on Canakya,
Joh. Klatt, Be trecentis Canakyae sententiis , Halle,
1873. There is no reason to doubt that this is an
early work, probably some time b. c. There are many
editions, and much variance of text.
The text is bounded on either side by two red lines.
Measurement of binding : ioj X 6j in.
No. of leaves: this MS. is the third part of MS.
Walker 205, which has ii+ 9+10 +20+ 20 + 62 (really
63, as f. 46 is repeated) + 9+71 + 9 leaves + ii blank.
Bate : f. 39V: samvata 1793 ( = a.d. 1737) na varase
vaisasamase suklapakse bljatithau srigunivasarena lasito
’yam |
239— MS. Wilson 520
Radharasasudhanidhi, A.D. 1700.
Cantents: the text i^ bounded on either side by
two red lines.
Measurement of binding : 7 j x 5 in.
No. of leaves : ii + 57 + ii blank.
Bate: f. 57 v : samvata 1846 ( = a.d. 1790) kdrttika-
vadi 10 I
240— MS. Walker 129 a
Ramakrsnakavya, A.D. 1779.
Contents: cf. MS. Sansk. c. 63 (1241).
The text occupies the centre, the commentary the
top and bottom, of each page. The whole is bounded
on either side by three red lines.
Measurement , fyc.: this is part 4 of the MS. described
under 08.
Bate: f. 1 94 v : samvat i835,( = a.d. 1779) phalguna-
sudi 15 bhaume likhitam l
Scribe: f. 194 v : agnihotrivyasatulasi tasyatmajena
Bhudevandmna likhitam asti l svatmdrthe pararthe ca 1
UbusI style of this scribe’s MSS.
VOL. I (229-245)
241— MS. Walker 192b
Ramavilasakavya, 18th cent.?
Contents: the text is bounded on either side by
a black line. ■ , -
Measurement , 8fC. : this is part 2 of the MS. described
under 792 .
Bate: f. 79 v : pramathinamasamvatsare kartikavadya
dasami somavare likhitam I By the Brhaspati cycle
this must be either a.d. 1749, 1750, or 1809, 1810.
Probably the latter.
242— MS. Walker 152^
Laksmistotra, A.D. 1704.
Contents : written like 225 .
Measurement , fyc.: this is part 4 (ff. 44-47) of the
MS. described under 240 .
Scribe: f. 289 v : pathanartham mdtdjanakijl l Cf. 225 ,
227 .
243— MS. Walker 129f
Vakratundastaka, 18th cent.?
Contents: the text is bounded on either side by
a yellow line between two red lines. The centre of
each page has the usual Jaina diagram, partially filled
up by either a cakra or a plain circle in red. Red spots
are also placed in either margin. Cf. on 730 .
Measurement , fyc.: this is part 6 of the MS. described
under 98.
Character : Jaina Devanagari.
244— MS. Wilson 519
Birudavali, 19th cent.?
Measurement of binding: 8| X in.
Material: yellow paper.
No. of leaves: ii + 37+iii blank. Arranged like
a European book.
245 —MS. Walker 209 a
Bilhanakavya, 17th cent.?
Contents: Bilhana flourished about a.d. 107c-
1090; his authorship of the Caurapancasika was
proved by BUhler, Report, p. 48. Cf. Bvihler’s Vikra-
mdhkadevacarita, p. 23 ; Ind. Ant., XX, 278. Edited,
with German translation, by Solf, Kiel, 1886.
The text is bounded on either side by two red lines.
Measurement of binding: io|x6| in.
No. of leaves : ii + 147 + ii blank. The three parts
32
CATALOGUE OF SANSKRIT MSS.
have 10 + 92 + 43 leaves. In part 3 l eaves are
arranged as in a European book.
Scribe: on f. 10: parlsabhudarajlnl jmstikd \
246— MS. Walker 152 c
Bhartrharisatani, A. D. 1743.
Contents: cf. MS. Sansk. c. 64 (1258). It seems very
probable that more than one hand is responsible for
the S'atakas, which were only collected by Bhartrhari,
see the evidence in Pathak, Journ. Bombay Br. R.A.S.,
XVIII, 347, 348. There is no reason to deny the
identity of the grammarian and the author of the
S'atakas, who therefore died in a. d. 650, Max Muller,
India, p. 348. On the other hand the attribution of
the Bhattikavya to Bhartrhari, ibid., p. 350, should be
given up, cf. Mitra, Notices, VI, 144—148. Ilultzsch,
Vienna Or. Journ., I, 138, referred to an inscription of
a. d. 653 by Dhruvasena III of Valabhi, where the
recipient is Bhattibhata, son of Bappa, and plausibly
conjectured that he was the author of the Kavya under
Dharasena IV, a. d. 641-651. This view he has since
abandoned, see Epigr. Ind., I, 92. Cf. also J.R.A.S.,
1904, p. 397, where the Kavya is ascribed to Vatsa-
bhat.ti of the Mandasor inscription.
The text is bounded on either side by two red lines.
Measurement of binding: io|x 6f in.
No. of leaves : ii + 289+ii blank. In the original
foliation the four parts are separately numbered, having
161 + 28 + 50 + 47 leaves.
Bate: f. 239 : samvat 1799 (= a. d. 1743) varse miti
asvanasudi 11 tithau 1
Scribe : f. 239 : lisatam sriamjunapuramadhye 1
Character: Jaina Devanagari.
247— MS. Walker 205 b
S'rngarasataka, 18th cent. ?
Contents: see MS. Sansk. c. 64 (1258) for a similar
dislocation of stanzas. The commentary is in Gujarati,
not Hindi, as stated in the Bodl. cat-al ., p. 402 a .
Edited with translation by M. R. Kale and M. B. Gurjar,
Bombay, 1898 ; with Krsnasastrin’s commentary, Nir~
yaya Sdgara press, 1888 ; Niti and Vairagya, by Telang,
Bombay, 1885. Translated by Tawney, Calcutta, 1877.
The text is bounded on either side by two double
red lines.
K. B. Pathak has discussed the question of Bhartr-
hari’s relations to Buddhism and to Kumarila, Journ.
Bombay Br. B.A.S., XVIII, 213 sq., 345 sq.
Measurement, 8fc.: this is part 2 of the MS. described
under 238.
Character: Jaina Devanfigari.
248—MS. Walker 200b
Suryastotra, 17th cent.P
Contents : the best title of the work is Sambapanca-
sika, and the author’s name is given as Samba,
in this MS. as well as elsewhere (Aufrecht, Catalogue
Catalogorum, p. 711, II, 170). The commentary
ignores verse 1, quoted in Aufrecht, but explains
verse 2 ( = verse 1 in Mitra, Notices, X, 88) thus:
tasmai bhagavate paravrahmane prakrstavrhattdrupuya
bodhagamydya gopataye gobharinyd patye tre proccdra-
kdya namah l yasya gopte traylmamdale rgyajuhsd-
masamuhe sdkhasahasravitate vistirnne vedagame 1 yad
githah sa pranavah 1 omkardkhyah sa puro ’gre aruna-
tayd sarathitvendbhyuditah I kathitah l &c. The MS. is
not very accurate. Edition of text and Ksemaraja’s
commentary in Kdvyamdld, no. 13, 1886.
The text is bounded on either side by two black lines.
Measurement, fyc.: this is part 2 of the MS. described
under 58.
249— MS. Wilson 487 b
Angarejacandrika, A. D. 1800.
Contents: in the colophon on f. 53 Vinayaka calls his
father jyotirvid. Ivampinya is the East India Co.
Measurement of binding : 5x7-^ in.
No. of leaves : ii + 53 + ii blank. The two parts have
22 + 31 leaves. Arranged like a European book.
Bate: f. 52: sailapanicagajacamdramite y bde 1 1857
vikramdrkanrpates ca tathaiva l netrabdhunagabhumimite
’bde I 1722 l (= a. d. 1800) sdlivdhananrpasya sakabde
11118 ll isemdsite pakse purnimdydm guror dine l Camdri-
ka purnam agamad dhimdmsos camdrikd iva 1111911
250— MS. Wilson 107 a
Mrcchakatika, A. D. 1822.
Contents: the date of the Mrcchakatika is still very
doubtful. For its antiquity are Windisch ( Ber griechische
Einfluss im ind. Drama, pp. 43 sq.), Kellner ( Progr.,
Zwickau, 1872). Against are Levi, Theatre ind.,
pp. 196 sq., II, 42; Pischel, Budrata and Ruyyaka,
pp. 16 sq., who seeks to assign it to Dandin, whom he
dates before Vamana (8th cent.?), cf. J.R.A.S., 1897,
p. 284. The later date is the more probable, but it is
impossible to determine the author. Formerly Pischel,
Gott. Gelehrte Anz., 1883, pp. 1232—1234, ascribed it to
Bhasa, cf. Schroeder, Ind. Lit., p. 629, note; Macdonell,
Sansk. Lit., p. 361. Peterson, Dasakumaracarita, II,
pp. 4-6, gives reasons why the verse limpatlva tamo
> ugdni should be regarded as not Dandin’s. He regards
APPENDIX TO VOL. I (245-257)
33
the Mrcchakatika as belonging to an epoch when people
were forgetting how to write Sanskrit, but the criticism
-would apply to all Sanskrit literature.
Edited by Jivananda Vidyasagara, Calcutta 2 , 1891;
translated by Fritze, Chemnitz, 1879.
Measurement of binding: 13 j x 6-| in.
No. of leaves: ii + 200 + ii blank. The two parts
have 136 + 63 leaves.
Bate: f. i36 v : savat 1878 ( = a.d. 1822) miti asvina-
krsna io (apparently corrected from asvina) I
251— MS. Wilson 338
Abhijnanasakuntala, 19th cent.?
Contents : important is the Bengali recension, edited
with critical notes by R. Pischel, Kiel, 1877, which
has 221 verses as against 194 of the Devanagarl recen¬
sion. The Kasmir recension, Burkhard, Die Kasmirer
Sakuntala-Handschrift, Wien, 1884, contains a pravesaka
to Act VI. There is also a Dravidian family of MSS.
Pischel, against Weber, Ind. Stud., XIV, has inferred
the superiority of the Bengali recension from the
Prakrit, which follows Vararuci’s rules closely, Die
Recens. der Sakuntala, Breslau, 1875 ; Ldvi, Theatre
Ind., II, 37, adds literary arguments (imitations in
Harsa and Rajaiekhara) to this view, and see now
Pischel’s Prakrit Grammar.
Editions also by Godabole and Parab, with Ragha-
vabhat^s commentary, Bombay, 1891; with English
translation and critical notes, by P. N. Patankar, Poona,
1889, and M. R. Kale, Bombay, 1898.
The text is bounded on either side by two red lines.
Measurement of binding : 11| x 9^ in.
No. of leaves : ii + 45 + i blank. Arranged like
a European book.
252— MS. Walker 201°
Abhijfianasakuntala, 17th cent. P
Contents: the text is bounded on either side by
two red lines. There are a few corrections.
Measurement, fyc.: this is part 5 of the MS. described
under 010,
253— MS. Wilson 233
Abhijfianasakuntala, A. D. 1710.
Contents: in the centre of each page is a square
blank space, with a small hole in the centre. The
paper varies considerably in colour, but seems to be
all of one date. __
Measurement of binding: 13IX 4J in.
No. of leaves: ii + 48 + ii blank. Originally foliated
8 - 55 -
254— MS. Wilson 40
Rasacandrika, 19th cent.?
Contents: Sankara seems to be fairly modern (15th
or 16th cent. T ). _,__
Measurement of binding : 17 J x yl in.
Material : yellow country paper.
No. of leaves: ii +115 +ii blank. The original
foliation makes 47 + 68 leaves.
255— MS. Wilson 305 a
Ranganatha on the Vikramorvasi, 19th cent. ?
Contents: the date is given on f. 47 v : nayanadha-
ranibhubhrdamite ’de 1712 ( = a. d. 1656, being meant
as usual for a samvat date) I nabhasye mi sitadala
iha nagdndm tithav arghuvarai ll See also Aufrecht,
Dior, catal., p. 155.
Measurement of binding: 1 i-J- x 9|- in.
No. of leaves : ii + 68+ i blank. The two parts are
foliated consecutively as 1—47, and 48—68.
256— MS. Wilson 308f
Malavikagnimitra, 17th and 18th cent. ?
Contents : on this play, which was doubtless Kali-
dasa^s first work, see L6vi, Theatre ind., pp. 166 sq .;
and Bollensen's edition, 1879; Shankar P. Pandit,
second edition, 1889; Seshadri Ayyar, with English
translation, Poona, 1896 ; translated by C. H.Tawney,
second edition, 1891.
The text is bounded on either side by two double
red lines.
Measurement, fyc. : this is part 6 of the MS. described
under 301.
257— MS. Wilson 311“
Malavikagnimitra, A. D. 1698.
Contents: the text is bounded on either side by
two double red lines.
Measurement of binding : 1x 5^ in.
No. of leaves: ii+35 +ii blank. The two parts
have 24+11 leaves.
Date: (1) f. 24 v : samvat 1754 ( = a. d. 169$) jet ha-
sudi 2 l (2) f. 24 v : sam 1880 ( = a. d. 1824) 1
Scribe : no name given ; for the reviser see f. 2q v :
yah kavyasdstrasatapatrasahasrarasmih sriman rama-
vidhuritafy puri Kalkitdyam (glossed by a later hand
Kalakatta) \ Lallesvarah sukavikairavakdnanemduh sud~
dharn sudhlr akrta Mdldvikdgnimitram 11111
BODL. SANS. CATAL. AFP.
34
CATALOGUE OF
258— MS. Wilson 220 a
Malavikagnimitra, 19th cent.?
Measurement of binding : I3x6|-in.
No. of leaves : ii + 190 + ii blank. The five parts m
the original foliation have 34+70+12+19 + 54 leaves.
Date: 1820 may be inferred from paper, &c.
Scribe: one hand is responsible for 258, 260, 275,
280, 283.
259— MS. Wilson 306
Malatimadhava, 10th cent.?
Contents: Bhavabhuti lived under Yasovarman of
Kanauj, and was an older contemporary of Vakpati,
author of the Gaiidavaho. Yasovarman was conquered
by Lalitaditya of Kasmlr, whose date is probably
a. d. 726-760 (not 695 as in Kalhana), see Biihler,
Vienna Or. Journ., II, 332 sq., as against S. P. Pandit,
Gaiidavaho , pp. lxvii sq. Pandit, p. ccvi, notes that in
one MS. Bhavabhuti is called the pupil of Bhatta
Rumania, who is not, however, the famous Mimamsist,
as Pandit supposes. Edited, with Jagaddhara’s com¬
mentary, by Bhandarkar, Bombay, 1876, and M. R.
Telang, 1892. See also L<3vi, Theatre ind ., pp. 212 sq.
Translated by Fritze, Leipzig, 1884.
Mananka is the prince’s name, Peterson, Deport ,
1884-1886, p. 10; Vienna Or. Journ., I, 319. He is
quoted by llayamukuta (a.d. 1431), Z.ZUI/.C?., XXVIII, I
117. Can he be the Manadeva of the Nepal dynasty,
a.d. 1139 ?
The MS. has been corrected here and there by
Wilson.
Measurement of binding : n-|x 9-- in.
Material: paper water-marked ‘ J. Budgen.’
No. of leaves: i+218+ ii blank. Arranged like
a European book.
260— MS. Wilson 229 b
Mahavlracarita, 19th cent. ?
Contents: edited by Anundoram Borooah with
a commentary and glossary, Calcutta and London,
1877, and at Poona in 1887 ; with Viraraghava’s com¬
mentary, by K. P. Parab, Bombay, 1892. Cf. L6vi,
Thedtre ind., pp. 269-272. Translated by Pickford,
London, 1871.
Measurement, Sfc.: this is part 2 of the MS. described
under 258.
261— MS. Wilson 160 a
Uttararamacarita, 19th cent.?
Contents: see on this drama L6vi, Thidtre ind.,
SANSKRIT MSS.
pp. 219 sq. Edited, with English translation, Nagpur,
1895, and with Viraraghava’s commentary, Nirnaya
Sdgara press, 1899. Translation in French by F. Neve,
Louvain, 1880; English, C. H. Tawney, Calcutta, 1871.
Measurement of binding: 14 x 6| in.
No. of leaves : ii + t 91 + ii blank. The four parts
in the original foliation have 39 + 32 + 46 + 70 leaves.
Date: f. 39 v : sammvat 1877 ( = a. d. 1821) mih
dsvanakrsna 2 vara ravivasara \
262— MS. Wilson 105c
Narayana on the Uttararamacarita, A. D. 1821.
Contents: see Mitra, Notices, VII, 235, no. 2479.
Measurement, Sfc.: this is part 3 of the MS. described
under 207.
Date: f. 138: sammvata 1877 ( = a. d. 1821, not
1822) mih dsvanakrsnasastivdra budhavdra 1
Scribe: as in 201.
263— MS. Walker 207 b
Anargharaghava, 17th cent. P
Contents: Murari’s date is more or less definitely
fixed by his relations to Ratnakara (about a. d. 850),
who alludes to him in Haravijaya, XXXVIII, 67 ;
L6vi, Theatre ind., p. 277, Kdvyamala, no. 5, p. 1.
Best edition by Durgaprasad and K. P. Parab, with
Rucipati’s commentary, Nirnaya Sdgara press, 1898.
The title should be Anargha 0 not Anarghya®.
The text is bounded on either side by two red lines.
Measurement , fyc.: this is part 2 of the MS. described
under 779.
264— MS. Wilson 232 a
Anargharaghava, A.D. 1821.
Contents: this is an inaccurate copy, partially
corrected by a later hand. Lacunae are marked on
ff. 5 V , 13, 39, 48 v . Act III has 61 verses, IV has 69,
VI has 86. This part ends on f. 48 v in the middle of
verse 55 of Act VII.
There are many translations, &c. in the margins,
doubtless by Wilson’s hand.
Measurement of binding: 13-^- x 6| in.
No. of leaves: ii + 108+ii blank. The volume con¬
sists of three parts with 48+14 + 46 leaves.
Date: this is by the same hand as part 3 which is
dated on f. 108 : samvata 1877 ( = a. d. 1821) 1
APPENDIX TO VOL. 1 (258-272)
35
265— MS. Wilson 230 c
Anargharaghava, A. D. 1821.
Contents: f. I92 v is blank, and there is a lacuna in
the text.
The MS. is inaccurately copied from a fairly good
exemplar. ■
Measurement, fyc.: this is part 3 of the MS. described
under 292.
Bate: f. 205 : samvat 77 ( = a.d. 1821 in all proba¬
bility) l It may be a Kasmir date = a. d. 1802.
266— MS. Wilson 108 d
Anargharaghava, A. D. 1821.
Contents: many notes have been added by a later
hand, which perhaps refers to itself in this note on
f. i82 v (after a note on ‘ ksirodarnavah *): iti praha
Lallddiksitavdmdhavakarali l Apparently the MS. was
copied by Lalladlksita, for whom see 250.
Measurement, fyc.: this is part 4 of the MS. described
under 201.
267— MS. Wilson 231*
Anargharaghava, A. D. 1821.
Contents: see Bhandarkar, Bombay catal., p. 17.
Probably the Bhairava who patronized Rucipati was the
Mithila prince of that name. This is made practically
certain by the colophon in Bhandarkar w hich mentions
his other name, Harinarayana. He flourished about
a. d. 1475, see buff, Chronol. of India, pp. 266, 305;
J.R.A.S., XX, 554. _
Measurement, fyc.: this is part 4 of the MS. described
under 285.
Bate: there is no authority for the date 1821,
though it is probable enough.
268— MS. Wilson 165*
Commentary on Anargharaghava, 19th cent. ?
Contents: the whole ends, on f. 177^: iti saptamo
9 mka cha \ Mundrivyd \ cha 1 Ramasyedam pustakam l
samksepatl i panam sampurna l cha \ Bdmacadaji l cha I
This means probably that the t.ippana was composed
by Ramacandraji, and probably this is his autograph.
Measurement, fyc.: this is part 4 of the MS. described
under 297.
269— MS. Wilson 308b
Abhiramamaninataka, 17th cent.?
Contents: the text is bounded on either side by
two dark red lines. ___
Former owner : f. 58 v : bhattaviresvariyam 1
Measurement, fyc.: this is part 2 of the MS. described
under 301.
270— MS. Wilson 492 b
Abhiramamaninataka, 19th cent. ? •
Contents : not at all accurate.
Measurement, fyc.: this is part 2 of the MS. described
under 304.
Bate : that of the archetype is given on f. 92 : vat
11585 ( = a. d. 1629) varse sravanasya krsne pakse
ptamyam tithau likhitam l
271— MS. Wilson 231b
Kamsavadha, A. D. 1821.
Contents: see Bhandarkar, Bombay catal., p. 133 ;
Weber, Catal., II, 148-151, who mentions that the
author’s patron was Govardhanadhariraja, son of
Todarak^itipati of the Tandanakula, who (see ibid.,
p. 1204) was finance minister under Akbar. Hence
Krsna must have flourished about a. d. i 600. The
colophon on f. 97 v is: iti srisesakrsnapamditaviracite
Kainsavadhanatake Ugrasenasya rdjyabhiseko nama
saptamo } mkah \ ajhanadosdn mativibhramad vd yatkim-
cid unam likhitam maydtra I tat sarvam aryyaih pariso-
dhanivyam prayena muhyamti hi ye likhamti 11
Edited in Kavyamala, no. 6 , where it is ascribed to
the second half of the 16th century. Cf. Schmidt,
Beitrdge z. indischen Erotik, I, 24.
Measurement, fyc.: this is part 2 of the MS. described
under 285.
Bate : f. 97 : sammvata 1877 sake 1743 ( = a. d. 1821)
miti asvana suklasastiam guruvasare gramtha samapta-
kamah 1
272—MS. Wilson 234 a
Citrayajfianataka, 19th cent.?
Measurement of binding: 13^ x 5-i- in.
Material: yellow country paper.
No. of leaves : ii + 61 + ii blank. The two parts have
21+40 leaves.
Scribe: the two parts are by different hands.
36
CATALOGUE OF SANSKRIT MSS.
273— MS. Wilson 231c
Damacarita, 19th cent.?
Contents : at the end of the MS. described by
Bhandarkar, Bombay catal., p. 146, this verse occurs:
acalagnirshndumite 1737 varse skamde ca buhulasya
site 1 srisamarajakavina racitam sriddmacaritam idam 11
This gives a. d. 1681 as the author’s date. There
is a mistake on p. 145, where the date of the MS. is
given as samvat 1731 ( = a.d. 1675). r lhc author also
wrote the SYhgaramrtalaharl, Stein, Kasnur catal.,
p. xxix.
Measurement, Sfc.: this is part 3 of the MS. described
under 286.
274— MS. Wilson 308e
Dhurtanartaka, A. D. 1799.
Contents: the text is bounded on either side by
two double red lines. Ff. 85, 89 are on red paper.
There are seventy verses numbered. Many corrections
have been made by a later hand, which has finished
the MS. and added a colophon.
Measurement, Sfc.: this is part 5 of the MS. described
under 301.
Date : f. 95 v : Dhurttanartakam iti prathitam yat
Samarajaracitam vasudhdydm 1 bdnabdnavasusomamite
} bde kartike budhajanartham alekhi tun i.e. samvat
18 55 ( = a. d. 1799).
275— MS. Wilson 229‘1
Dhurtanartaka, 19th cent.?
Contents: samdhi 1 ends on f. 1 z6 v . Some corrections
have been made at the beginning. On f. 118 V is quoted:
vanddrur abhivddake ity Amarah \
Measurement, Sfc.: this is part 4 of the MS. described
under 268.
276— MS. Walker 213*
Dutangada, 17th cent.?
Contents: the Kumarapalesvara for whose yatra this
was written is probably the famous prince of that
name, a. d. 1088-1172. Subhata is mentioned in the
Kirtikaumudi. See the edition in Kdvyamdld, no.28,p. 1,
note. Cf. Mitra, Bikaner catal., p. 251, who takes
chayanataka as meaning ‘ shadow of a drama.’ Bendall,
J.R.A.S., 1898, p. 229, Brit. Mus. catal., p. 105, ascribes
it to the reign of Tribhuvanapala (a. d. 1242, 1243).
Measurement of binding: iOj x in.
No. of leaves : ii + 204 + ii blank. Parts 1 and 2 have
4+10 leaves.
277— MS. Wilson 308*1
Dutangada, 17th cent.?
Contents: the text is bounded on either side by
two double red lines.
Measurement, fyc.: this is part 4 of the MS. described
under 301.
278— MS. Walker 200 f
Dutangada (plot of), A.D. 1772.
Contents: the text is bounded on either side by
two broad red lines.
Measurement, fyc.: this is part 6 of the MS. described
under 180.
Date: f. 161: samvat 1828 (a. d. 1772) caitrasudi 1
sanau likhitam I
Scribe: f. 161 : ugnihotrivydsasri 5 tulasitatputra
Bhudevandmna vilikhitam asti l Usual style of this
scribe’s MSS.
279— MS. Wilson 492 c
Dhananjayavijaya, 19th cent. P
Contents: see Bhandarkar, Bombay catal., p. 28 ;
| Burnell, Tanjore catal., p. i68 l> . Edited with notes by
Taranatha Tarkavacaspati, Calcutta, 1871, and in the
Nirnaya Sdgara press, 1895. It was written for a
Jayadeva, and two verses appear in the Mahaniitaka,
Ldvi, Theatre ind., p. 251, App., p. 47. Translated
into Hindi by Hariscandra, Benares, 188.3.
Measurement, fyc.: this is part 3 of the MS. described
under 304.
280— MS. Wilson 229 c
Dhananjayavijaya, 19th cent.?
Contents : many lacunae are marked.
Measurement, fyc.: this is part 3 of the MS. described
under 258.
281— MS. Wilson 514*
Dhurtasamagama, 17th cent.?
Contents: the date of the author most probably is
the 15th century. Cf. Levi, Theatre ind., pp. 252 sq.
Edited by Cappeller, n. d.
The text is bounded on either side by two double
red lines. On f. 13 is written : yat khanditapustakdvaseso
tad anyasmad granthac chrildsena sahavena sodhitdn
mudritac ca niskrsya mayd likhito ’ yam \ sam 1843 1
Measurement of binding : io| x 6f in.
No. of leaves: ii + 45 + ii blank. The two parts
have 13+32 leaves.
APPENDIX TO VOL. I (273-288)
37
282— MS. Wilson 311 b
Pracandapandava or Balabharata, 18th cent.?
Contents: cf. also L6vi, Theatre ind ., p. 229* Edited
by Cappeller, Strassburg, 1885.
The text is bounded on either side by two red lines.
Measurement, Sfc.: this is part 2 of the MS. described
under 257.
283— MS. Wilson 230d
Pracandapandava, 19th cent. P
Contents : there are many lacunae. By a blunder on
f. 224, a quotation is introduced from the Medinikosa
beginning: nako stri rudracape, &c.; it ends, on f. 225 :
iti kamtafy samaptafy I after which the play continues.
Measurement, Sfc.: this is part 4 of the MS. described
under 292.
284— MS. Wilson 305^
Viddhasalabhanjika, 19th cent.?
Contents: Rajasekhara’s date has been finally
determined by means of inscriptions. He flourished
under Mahendrapala (a. d. 903-907), and Mahipala
(a. d. 917) of Kanauj, see Ind. Antiq., XYI, 175 sq.;
Kielhorn, Epigr. Ind., I, 170,171. Against this, the
fact that he does not mention Murari is of no moment,
despite Ldvi, Theatre ind., II, 45. On the author cf.
L6vi, pp. 245-248; Y. S. Apte, Rajasekhara, his life
and writings, Poona, 1886.
Edited by Jivananda Vidyasagara, Calcutta, 1883.
Measurement, Sfc.: this is part 2 of the MS. described
under 255.
Scribe: it is possibly by the same hand as 255.
285— MS. Wilson 231 a
Pradyumnavijaya, 19th cent.?
Measurement of binding: 14 X 6 f in.
No. of leaves: ii+ 182 (really 183, f. 96 being repeated)
+ ii blank. The four parts in the original foliation
have 62 + 36 + 36 + 48 leaves.
Rate : f. 62 : samaso ’yarn gramthas tena snkrsnah
prlyatam rasamkavajividhumirmite 3 bde sami madhava
samvat 1877 ( = a.d. 1821, not 1822 as Bodl. catal.) 1
Clearly the first part must refer to the date of the
exemplar whence this copy was made, i. e. samvat 1796
( = a.d. 1730).
Scribe: in this volume parts 3 and 4 are by one
hand. Parts 1 and 2 are by different hands.
286— MS. Walker 183
Prabodhacandrodaya, 17th and 18th cent. P
Contents: best edition, Nirnaya Sagara press, 1898.
Translated by Taylor, Bombay, 1886. Analysed by
Levi, Theatre ind., pp. 229-235. Krsnamisra lived
under the Candella prince Kirtivarman, whose victory
over Karana, the Cedi, he describes, Epigr. Ind., I, 220.
His date lies therefore between a. d. 1047 and 1093,
not in the 12th century, as Schroeder, Ind. Lit., p. 659.
The text is written in the centre, the commentary
at the top and bottom, of each page. In ff. 33-89 the
writing is bounded on either side by two red lines, so
also on ff. 90—102. In the latter part a good many
corrections have been made by a later hand.
Measurement of binding : 12 j x 6| in.
No. of leaves: ii +102+ ii blank. By the original
hand the first section is foliated 1-32, the second
29-85, the third 1-13.
Bate:
(1) f. 89: samvat 1787 varse sake 1652 ( = a. d.
173°) pravarttamane dvitiyabhadrapadamase krsnapakse
7 (?) amavasya guruvasare I
(2) f. i02 v : samvat 1703 varse ( = a. d. 1647) caitra-
mase suklapakse trtiydyam tithau 1 ravidine I
Scribe:
(1) ‘f.89: pamdyaP purusottamasutakrsnadevena
paropakdrdtham 1
(2) f. I02 v : jo° Harajiddkhyena prakrtam sa -
samskrtam likhitam t
287— MS. Mill 1
Prabodhacandrodaya, 19th cent.?
Contents: the words of the text are separated by
small strokes above the line. The Sanskrit version of
the Prakrit passages is written in pale red ink. Cf.
223, which is doubtless by the same hand.
Measurement of binding : i6|- x 5^ in.
Material: yellow country paper.
No. of leaves : i + 57+iii blank; originally counted
as 112 pages.
288— MS. Wilson 313
Commentary on the Prabodhacandrodaya,
19th cent.?
Contents : see Mitra, Notices, VII, 136 (a MS. of
a. d. 1760 apparently).
Measurement of binding : 11x7-7 in.
38
CATALOGUE OF
Material: brown country paper. Ff. 9, 10, 21-48
are yellow.
No. of leaves: i +48 + 1 blank. Arranged like a
European book.
289— MS. Wilson 105^
Prasannaraghava, A.D. 1822.
Contents: Jayadeva’s date is (1) certainly earlier
than the Sarrigadharapaddhati (a. d. 1363), (2) some
of his verses being used in Damodara , s recension of
the Hanumannataka, perhaps also earlier than the 10th
cent. a. d., L6vi, Theatre ind., p. 281, II, 48.
Edited by K. P. Parab, 1893, and by S. M.
Paranjpe, Poona, 1894.
Measurement, Sfc.: this is part 2 of the MS. described
under 297.
Late : f. H4 V : samvat 1877 (a. d. 1821) l
Scribe: see 207.
290— MS. Wilson 229^
Madhuraniruddha, 19th cent.?
Measurement, 8fc.: this is part 5 of the MS. described
under 258.
Material: European paper, with water-marks of
various firms.
Late : the year 1823 is the latest in the water-marks.
291— MS. Wilson 228 b
Mahanataka or Hanumannataka, 19th cent.?
Contents: seeWeber, Catal., II, 157; Mitra, Notices,Y,
27-30. Printed at Bombay in 1886 ; by Jlv&nanda Vi-
dyasagara, Calcutta, 1890. Pischel, Gott. Gelehrte Anz.,
1885, p. 761, has noted that Anandavardhana mentions
a Mahanataka, 60 that some recension must have existed
before Bhoja, cf. L<£vi, Theatre ind., p. 243, II, 46.
The text is placed in the centre, the commentary at
the top and bottom, of each page.
Measurement, fyc.: this is part 2 of the MS. described
under 308.
292— MS. Wilson 230 a
Mahan&taka, 19th cent,?
Contents: apparently the original ff. 1—3 have been
lost, and are supplied by ff. 1-5 in a recent hand.
Another hand has written ff. 69-96. The text is
bounded on either side by four red lines up to f. 60.
The MS. is much corrected.
Measurement of binding: 13^-x 6^ in.
No. of leaves : ii+227+ ii blank. The four parts
SANSKRIT MSS.
have, in the original foliation, 99 (numbered 1-5 and
4-96, f. 63 being double) + 48 + 58 + 22 leaves.
Date : the date 1820 is merely an inference from
the writing.
293— MS. Wilson 168 ft
Mahanataka, A.D. 1822.
Contents: the text occupies the centre of each page,
the commentary the top and bottom. The MS. has
been corrected here and there by Wilson.
Measurement of binding : 137X 8j in.
No. of leaves: ii+125 + ii blank. The two parts
have 89 + 36 leaves.
Late: f. 89: samvata 1878 sake 1743 ( = a.d. 1821) l
294— MS. Wilson 167 b
Mahanataka, 10th cent. P
Measurement, §c.: this is part 2 of the MS. described
under 250.
295— MS. Wilson 172 a
Mah&nataka, 10th cent.?
Measurement of binding : 16^ X 5 in.
Material: yellow country paper.
No. of leaves : ii + 164+ ii blank. The two parts in
the original foliation have 97 (really 98, as f. 71 is
repeated)+ 67 leaves (really 66, as there is no f. 58).
296— MS. Wilson 108 b
Mudraraksaaa, A.D. 1821.
Contents : the reference in the last verse (f. 125
in this MS., parthivodharmavartl) to Avantivarman is
explained by Telang in his edition, and by Hillebrandt in
Z.L.M.G., XXXIX, 131, of the father of the Maukhari
Grahavarman (about a. d. 600), and the latter suggests
that the poet, who is called in a Paris MS. son of
Bhaskaradatta, was a prince of Kamarupa, since
Rajyavardhana’s ally of that country was Bhaskara-
varman. Jacobi, Vienna Or. Journ ., II, 212 sq., has,
however, made it probable from the style, which is not
Gaudlya, from the reference to Kuluta (Kullu in
Panjab), and from a possible imitation of Ratnakara,
that the poet was a Kasmlrian and composed his work
for Sura, Avantivarman’s minister, on Dec. 2, a. d. 860.
Cf. on this drama, L6vi, Thiatre ind., pp. 225—228. The
best edition is Telang , s, second edition, 1893. Trans¬
lated into German by Fritze, Leipzig, 1887.
Measurement, fyc.: this is part 2 of the MS. described
under 293.
Late: f. 125 : samvat 1877 (a. d. 1821) miti asudha-
sukla 2 mamdavasare \
APPENDIX TO VOL. I (288-304)
39
297— MS. Wilson 166 4
Mudraraksasa, A. D. 1821.
Measurement of binding : 14 x 6-1 in.
No. of leaves: iv+177 + iv blank. The four parts
n the original foliation have 53 + 59 + 24 + 38 leaves
[really 39, as f. 33 is repeated).
Date: f. 54: samvat 1877 ( = a.d. 1821) \
Scribe: 289 seems to be by the same hand.
298— MS. Wilson 169
Mudraraksasa, A.D. 1823.
Contents : the MS. is inaccurate.
Measurement of binding : 142- x 8-| in.
No. of leaves : ii + 97 + ii blank.
Date: f. 97 v : samvat 1879 ( = a. d. 1823, but the
figures have been added by another hand) miti asadha-
sudipaurnamasi gramtha sampurtiam l
299— MS. Wilson 232 b
Mudraraksasa, 19th cent. P
Contents: the MS. is inaccurate, and there are
many lacunae not marked in the text.
Measurement , fyc.: this is part 2 of the MS. described
under 264.
Scribe .* probably written by the same hand as 308.
300— MS. Wilson 232c
Vate5vara on the Mudraraksasa, A.D. 1821.
Contents: see Mitra, Notices, VII, 240, 241. The
title given in Mitra and in the colophon on f. 108 is
Mudraprakasa.
Measurement , Sfc.: this is part 3 of the MS. described
Under 264.
Date : on f. 108, at the end of the colophon : asa(ha-
sudipuranavdsd samvata 1877 ( = a.d. 1821) 1
301— MS. Wilson 308
Yayaticarita, A.D. 1801.
Contents: the reference in the Sahityadarpana,
p. 195, is now explained by Aufrecht, Catalogus
Catalogorum , p. 638, of a Bhagavata Krsna Kavi’s
work. The present work seems to be quite modern
(16th or 17th century).
The text is bounded on either side by two double
red lines, and has been a good deal corrected by a later
hand. _
Measurement of binding : 12-| x 5^ in.
No. of leaves: ii+154 +ii blank. The seven parts
in the original foliation have 31 + 31 (really 27, as
ff. 4, 5, 14, 15 are lost) + 20 + 3 + 14 + 36 + 23 leaves.
Date : f. 3i v : srlsamvat 1857 ( = a. d. 1801) vyapa -
puyakuklacaturdasyam vara camdrasasare \
302— MS. Wilson 344
Yayatioarita, 19th cent. P
Measurement of binding: 13- x 9| in.
Material: European paper, water-marked ‘S. &
C. Wise.’
No. of leaves: ii + 21+ iv blank. Arranged like
a European book.
Date : the latest date in the water-marks is 1810.
303— MS. Wilson 166 b
Batnavali, A.D. 1821.
Contents : the authorship of the Ratnavali is disputed,
but it is absolutely impossible to decide the question,
and the author must remain anonymous. Bana, who
is credited with the work by the Kavyaprakasa,
Biihler, Kastnir Report, p. 69, wrote a drama, the
Parvatiparinaya, which is in a much inferior style.
See Fritze, Pref. to Transl. ; Schroeder, Ind. Lit.,
p. 647 ; Ldvi, ThSdtre ind., p. 185 ; Macdonell, Sansk.
Lit., p. 362.
Best edition by Cappeller, in Boehtlingk’s Chresto-
mathie, third edition, 1897. Also in Nirnaya Sugara
press, 1882, and, with Govinda’s commentary, by
K. P. Parab, 1895. Translated into German by Fritze,
Chemnitz, 1878.
The MS. is a good deal corrected, apparently from
other MSS. This MS. was used for Cappelleris edition.
Measurement, fyc. : this is part 2 of the MS. described
under 261.
Date : f. 72 : samvat 1877 ( = A. D. 1821) I
304— MS. Wilson 492 4
Batnavali, A.D. 1821.
Contents : the text is much corrected, in red ink, by
a later hand in the first six leaves. Used for Cappelleris
edition. -
Measurement of binding : io|-X 5! in.
No. of leaves: ii+106 +ii blank. The three parts
as originally foliated have 53 + 39 + 14 leaves.
Date: f. 53 v : samvat 1877 ( = a. d. 1821) samai
jyestavadi 10 l
Scribe : f. 53V: Parasulala lipyate \ He also wrote
93, 94.
40
CATALOGUE OF SANSKRIT MSS.
305— MS. Wilson 343
Vidagdhamadhava, 19th cent.?
Contents: the date is not 1549, but 1533 (sindura
= 8), Aufrecht, Catalogus Catalogorum, II, 135.
Cf. on this drama Levi, Theatre bid., p. 237.
Measurement of binding : 12^ x 9]- in.
Material: yellow country paper.
No. of leaves: i + 52 + i blank; originally reckoned
as 104 pages.
306— MS. Wilson 172b
Venisamhara, 19th cent.?
Contents: Bhattanarayana is cited in Anandavar-
dhana, who flourished under Avantivarman of Kasmir,
a. d. 855-884, according to the Rajataranginl, V, 39
(defended successfully by Jacobi, Vienna Or. Journ.,
IV, 237 sq., against Pischel, Rudrata , p. 22). He has
been held to be the recipient of a copper-plate from
Khfdimpur, Gaur, of probably .about a. d. 840, of
Dharmapala of Bengal, Journ. Beng. As. Soc., LXIII,
pt. i, p. 39, but see Epigr. hid., IV, 243. On his work
cf. L^vi, Theatre ind., pp. 224 sq.
Edited by J. Grill, Leipzig, 1871 ; with Jagaddhara’s
commentary, by Godabole, Poona, 1895; by K. P.
Parab and K. R. Madgavkar, 1898. English translation
by S. M. Tagore, Calcutta, 1880.
Measurement , fyc.: this is part 2 of the MS. described
under 295.
307— MS. Wilson 230b
Venisamhara, A. D. 1821.
Contents: yellow pigment is much used for correc¬
tions. The text is very inaccurate.
Measurement, Sfc.: this is part 2 of the MS. described
under 292.
Bate: f. 147 : sainvat 1877 ( = a. d. 1821) I
308— MS. Wilson 228 »
Venisamhara, A. D. 1821.
Contents: Wilson has carefully corrected the MS.
by help of a tika, and marked many verses as interpo¬
lations. Act I ends on f. ; II, 0 n f. 20.
Measurement of binding: 13 j x 7^ in.
No. of leaves: ii+118+ ii blank. The two parts
have 29 + 89 leaves.
Scribe: different from that of part 2. Cf. 299.
309— MS. Wilson 106 c
Jagaddhara on the Venisamhara, 19th cent.?
Contents: edited with the text by K. P. Parab and
K. R. Madgavkar, Nirnaya Sdgara press, 1898.
Measurement , Sfc.: this is part 3 of the MS. described
under 201.
310— MS. Wilson 302
S'aradatilaka, 19th cent.?
Contents: doubtless a copy of the MS. on palm-
leaves, in Telugu character, described by Wilson,
Mackenzie Coll., p. 158, no. 42; perhaps even in
Wilson’s own hand.
The text is surrounded by a single pencil-drawn
line, and has been corrected in many places. F. 4 V is
blank. Some translations are written in the margins.
Aufrecht’s conjecture as to the identity of the author
with that of 214 seems very probable, because of the
absurd amount of attention paid in both works to the
piling up of similar sounds in a line (paronomasia).
Measurement of binding: 12^-x 8^- in.
Material: paper water-marked ‘ J. Whatman ’
and * Balston & Co.’
No. of leaves : v + 18 + v blank ; originally counted
erroneously as 32 pages. Arranged like a European
book.
311— MS. Wilson 514b
Hasyarnava, A. D. 1821.
Contents : edited by Cappeller. Contents sketched
by Levi, Theatre ind., pp. 253, 254.
Measurement , fyc. : this is part 2 of the MS. described
under 281 .
Bate : f. 45 : samvat 1877 ( = a. d. 1821 ) jyestasukla-
paksa 5 1
Scribe : f. 45 : likhitam Ramacamdrapaniditakasmlrl
Kashnadhye 1
Character : Devanagari, with some traces of Kasmir
style.
312 —MS. Wilson 308s
Hasyarnava, A. D. 1835.
Contents : this edition appears in neither of the
printed catalogues of the British Museum.
Measurement , 8 fc.: this is part 7 of the MS. described
under 301 .
Bate: f. I54 v : pausafy 41 sakabdafy 1767 ( = a. d.
1835)1
APPENDIX TO VOL. I (305-320)
41
313
See Prakrit Catalogue.
314 — MS. Mill 20
Rajatarangini, A. D. 1834.
Contents: the Rajatarangini was written in a. d.
1148—1150, and Kalhapa ( = Kalyana) is mentioned
by Mankha in his Srlkanthacarita as a kavi (a. d.
1124—1144). The criticism of the Rajatarangini was
begun by Buhler with the aid of MSS. found in Kasmlr,
and Dr. Stein has published a critical text, 1892, and
a translation with an historical introduction, 1900.
It was also edited by Durgaprasada, Bombay, 1892—
1896, and translated by J. C. Dutt, Calcutta, 1879-1887,
but only Stein’s edition is of any value. All the
extant MSS. are derived from the archetype of Ratna-
kantha, about a. d. 1650. See J.R.A.S., 1900, p. 187.
For Srivara see Bhandarkar, Report, 1883, 1884,
p. 54; Stein, II, 373. He continued the poem from
a. d. 1459-1486. Prajyabhatta continued it with his
pupil Suka to a. d. 1586.
Three hands must be distinguished.
Measurement of binding : 14-j X 7J in.
No. of leaves : ii +188 + ii blank.
Pate: f. 188: sarnvat 1890 ( = a. d. 1834) miti ma-
ghavadi avasasanicaravara I
315 — MS. Wilson 301
Jonaraja’s continuation of the Rajatarangini,
A. D. 1822.
Contents: Jonaraja wrote his commentary on the
Kiratarjunlya about a. d. 1448. He brought the Raja-
taranginl down to a. d. 1459. See Bhandarkar, Report,
1883, t 884, p. 54; Buhler, Kasmlr Report, p. 61; Stein,
H> 373 -
The MS. is very prettily written in large letters.
The text is bounded on either side by five lines of red,
yellow, and blue. ____
Measurement of binding : 11-| x 7in.
No. of leaves: ii + 139+ii blank. Arranged like a
European book.
Pate: f. I39 v : sarnvat 1878 ( = a.d. 1822) caitra-
suklacaturdasyam somavasare 1 It is also given in
verse: Vikramarkad gate kale vasusaptastacamdrake 1
caitrarjunacaturdasyam vare kaumudabamdhave II
Scribe: f. 139 v • Hkhita Sadasukhakenemdraprasthe I
Also in verse: om Saddsukhena Misrenalekhi Rdja-
taramgini 1 Indraprasthe nivasata pharljanahitaya vai 11
■ BODL. SANS. CATAL. AFP.
316 — MS. Wilson 303»
Rajatarangini and Rajavalipataka, 10th cent. ?
Contents: the text is carelessly written.
Measurement of binding : 13 X 9^- in.
Material: paper water-marked ( S. & C. Wise.’
No. of leaves : i + 42 + i blank. Originally foliated
in two main parts having (4+ 11)+ 27 (5 parts) leaves.
Arranged like a European book.
Pate : paper water-marked 1810.
317 — MS. Wilson 420i
Fragment relating to Paramara’s descendants,
10th cent. ?
Measurement, fyc.: this is part 8 of the MS. described
under 551 .
318 — MS. Walker 207 c
Rasikaramana, 16th cent. P
Contents: the text is bounded on either side by two
double red lines. The difference in age between the
two hands is not necessarily at all considerable.
Measurement, fyc.: this is part 3 of the MS. described
under 770 .
Character : Jain a Devanagarl.
319 — MS. Wilson 237 b
Viivagunadarsa, 10th cent.?
Contents: see Mitra, Notices, III, 322 (inaccurately
described). Quoted in Atharvanarahasya. Printed at
Madras, 1879, with Subbasastrin’s commentary, and
with that commentary and notes by Shamarav Vithal,
Bombay, 1889. ^ ee Keith, Ind. Inst, catal., p. 85.
Measurement, fyc.: this is part 2 of the MS. described
under 517 .
Scribe: by a different hand from part 1.
320 — MS. Mill 17
Rhojaprabandha, 10th cent.?
Contents : often edited in India, e. g. by K. P. Parab,
Bombay, 1896. The words in the MS. are frequently
separated from one another by a small space.
Rahganatha, fourth son of Ballala Ganaka, composed
in a. d. 1603 the Suryasiddhantagudharthaprakasaka,
Eggeling, India Office catal., p. 996.
Measurement of binding: 15^ x 4^ in.
Material: yellow country paper.
No. of leaves : i + 70 + i blank.
o
42
C ATALOGUE OF SANSKRIT MSS.
321 - 324 — MSS - Wilson 316-319
Kathasaritsagara, A. D. 1824.
Contents : Somadeva wrote this work for the Queen,
Satyavali, between the resignation of Anantadeva of
Kasmir (a. d. 1063) and his death (a. n. 1081); see
Bidder (iii correction of his earlier account, Kasmir
Report, p.50), Sitzungsb. d. IViener Akud. {Phil.-hist. Cl.),
OX, 545 sq.; S. Levi, Journ. As., 8 ° ser., VII, 216 sq.
The original which he used, by Gunadhya, in Paisaci
bhasa, is quoted in Dandin and Subandhu, and must
belong to the early part of the 6th cent, at latest.
Bidder assigns it to the 1st or 2nd cent. {Report,
]>. 47). Probably the 3rd century is the earliest date,
as the references to Sarvavarman in the Kathasaritsa¬
gara arc probably derived from this source, and point
to the latter part of the 2nd cent. a. d., cf. Bhandar-
kar, Hist. Deccan , 2 pp. 170, 171. Ilaraprasada Sastrin,
Notices, XI, 7, claims to have found an old fragment
of a Sanskrit metrical version of the Vrhatkatha,
anterior to Ksemendra (a. d. 1020-1030) or Somadeva.
316, 317, 318, ff. 78-112 are by one hand, 318,
tf. 1-77, 113-178 and 310 by another. Wilson has
written in the margin many notes and translations.
Edited by Brockhaus, Leipzig, 1839-1866 ; by
Durgfiprasada and K. P. Parab, Nirnaya Sugar a
press, 1889. Translated by Tawney, Bill. Ind., 188c-
1887. _
Measurement of binding: ii^X9jin. approximately
for each volume.
Material: paper water-marked ‘ C. Wilmoth
No. of leaves: 316 = i + 210 + ii blank ; 317 = 0+179
+ ii blank ; in the original foliation numbered consecu¬
tively as 1-389. 318 = i + 178 + i blank ; 310 = i + 204
+ i blank. Arranged like a European book.
Date : 318, f. 77 v : srlsamvat 1880 ( = a. d. 1824)
raisdkhasuklacaudaiybm bhraguvdsare pustakam sa-
mdptam 1
325 — MS. Mill 33
Kathasaritsagara* 19th cent.?
Contents: there are various notes in Mill’s hand,
and he has corrected the text occasionally. The MS.
is inaccurate and several lacunae are marked.
Measurement of binding: 13-®- x 8-jj- in.
No.of leaves: ii + 164 + iiblank. The MS. is evidently
only part of a volume, as the ff. are numbered 616-779.
326— MS. Marsh 328^
Simhasanadvatrimsatputrikavartta, A. D. 1663.
Contents : on the southern recension, as found in
the Tubingen MS., the Madras edition of 1861 by
Krsnam Acarya, and in Jivananda Vidyasagara’s edition,
Calcutta, 1881, see Weber, Ind. Stud., XV, 232-242.
Measurement, fyc.: this is part 2 of the MS. described
under 335.
Date: f. 171 v : samvat 1709 ( = a. d. 1653) varse
jyesthakrsnaikddakydm sandv ulam likhitam 1 This
looks like the date of the original.
327— MS. Wilson 242 c
Vetalapancavimsati, 19th cent. ?
Contents: see Mitra, Notices, I, 69; printed by
Jivananda Vidyasagara, Calcutta, 1888. Two other
recensions,S'ivadasa’s and an anonymous one, have been
edited by II. Uhle, Abhandl. f. d. Kunde d. Morgen-
landes, VIII, 1. _
Measurement, §c.: this is part 3 of the MS. described
under 230.
328— MS. Wilson 327
Katharnava, A. D. 1824.
Contents: the Caitanyadeva of f. 72'' is possibly the
famous Vedantist, who lived about a. n. 1485-1527.
If so, this work cannot be earlier than the 16th cent.
The text is bounded on either side by two red lines.
F. 73 contains a list of the Ivathas.
Measurement of binding: 13T X 6-7 in.
No. of leaves : ii + 73 + ii blank.
Date : f. 73 : samvat 1880 (=a.d. 1824) 1
329— MS. Walker 2O0f
Bharatakadvatrimsika, A.D. 1675.
Contents: see Aufrecht, Flor. catal., p. 35.
The text is. bounded on either side by two red lines
up to f. ii5 v . _
Measurement, §c.: this is part 6 of the MS. described
under 68.
Date: f. 126 : samvat 1731 ( = a.d. 1675) varose srd-
vanasuda 3 gurau lakhitam 1
330— MS. Wilson 303 a
S'ukasaptati, 10th cent.?
Contents : for the various recensions cf. R. Schmidt,
Vier Erzahlungen aus der Sukasaptati, Kiel, 1890, and
his edition, Leipzig, 1893, Munich, 1898, translated,
Kiel, 1894, Stuttgart, 1898. This is possibly a work
of the nth or 12th cent. Windisch, Litt. Centralblatt,
1891, p. 343, refers to Prakrit and artificial forms
in the B recension. Schmidt has published the
textus simplicior in the Z. D. M. G., LIV and LV.
Measurement of binding: 12-| X 5! in.
APPENDIX TO VOL. I (321-335)
43
No. of leaves : ii + 87 + ii blank. The four parts in
the original foliation have 39 + 8 + 27 + J3 leaves.
331 —MS. Wilson 323 b
S'ukasaptati, 19th. cent.?
Measurement , §c.: this is part 3 of the MS. described
under 158.
332 — MS. Wilson 37
Vasavadatta, 10th cent.?
Contents: Hall in 1855-1859 edited this text with
Slvarama’s commentary. In the preface he established
Bana’s date, and showed that he quoted Subandhu’s
work. No further evidence has yet been found, since
neither Bharavi’s or Magha’s dates are fixed (assuming
with Jacobi, Vienna Or. Journ., Ill, 121, that these
poets are previous to Subandhu, but see as to
Magha, J.R.A.S. , 1906, p. 728), but if Subandhu is
posterior to Bharavi, then he must be posterior to
Kalidasa (about a. d. 400). Probably a. d. 500 is
about his date. Peterson, Report, 1884—1886, p. xxiv a ,
withdraws his theory ( Report , 1882, 1883, App.,
pp. 109 sq.) that this Vasavadatta is not the work
quoted by Bana. See also Biihler, Die indischen
Inschriften, p. 20; Vienna Or. Journ., I, 115, where
Cartellieri shows imitations by Bana.
The commentary is written at the top and bottom.
Edited, with commentary, by Jivananda Vidyasa-
gara, Calcutta, 1874.
Measurement of binding : 16J- X 6 in.
Material: yellow country paper.
No. of leaves : ii + 91 + ii blank.
333 — MS. Wilson 328b
Jagaddhara on the Vasavadatta, 19th cent. ?
Contents: this is according to Hall the oldest
commentary extant. It is posterior to mi a. d.,
the date of the Visvaprakasa. Cf. Burnell, Tanjore
catal., p. 162; Mitra, Notices, V, 304. But it is
anterior to a. d. 1599 as a MS. of his Sarasvatikantha-
bharanavivarana bears that date, Stein, Kasmir catal.,
pp. xxix, 276. (The two Jagaddharas in Aufrecht,
Catalogus Catalogorum, p. 195, should be amalgamated.)
Measurement, fyc.: this is part 2 of the MS. described
under 235.
Material: yellow country paper.
334 — MS. Wilson 341
Kadambari, 19th cent. P
Contents : edited by P. Peterson, Bombay, 1889;
and at the Nirnaya Sagara press with Bhanucandra and
Siddhacandra’s commentary, 1896; by M. R. Kale,
Bombay, 1896. Translation of the first part with an
abstract of Bhusanabhatta’s continuation by C. M.
Ridding, London, 1896.
In this MS. the purvabhaga is attributed to Bana,
the uttara to his son. The former has 5,600 grantha,
the latter 8,500. Stein, Kasmzr catal., p. xxxvi, gives the
son’s name as Bhatta Pulina, and on p. 299, the main
divergencies from Peterson.
Measurement of binding : 11 f x gf in.
Material: paper water-marked f S. Jones.’
No. of leaves : i + 179 +i blank. In the original
foliation 119 (f. 120 is blank)+ 59. Arranged like a
European book.
Date : the latest date in the water-mark is 1809.
335 — MS. Marsh 328 a
Pancatantra, A. D. 1053.
Contents: the date of the Pancatantra is very un¬
certain. Its latest date is fixed by the fact that
Purnabhadra in the year 1255 revised an edition for
Soma, Bhandarkar, Report, 1887-1891, p. lx. This
is probably—as in most cases where no specification is
made — a Vikrama date (=a. d. 1199). On the other
hand verse 8 (ed. Kielhorn) of chap. IV is identical
with S'rngaratilaka, I, 68, and Rudrabhatta is dated
in the nth cent, by Jacobi, Vienna Orient. Journ., II,
156. Again, verses from Bhartrhari (a. d. 625), Naga-
nanda (a. d. 645 ?), Muktaplda (a. d. 726-762), Udbhata
(under Jayaplda, a. d. 779-813) are said to be used
by the author (for the last two see Buhler’s edition, II,
81, V, 34). Finally, according to the Sarngadharapad-
dhati, 455, II, 130, is a verse of Krsnamisra’s (a. n.
1090?). This would point to a date about a. d. iioo-
1150 for this recension of the northern Pancatantra,
but the quotations are of course rather doubtful.
There are several Versions of the northern recension,
that of Kosegarten, that of Kielhorn and Buhler’s
edition, Bombay, a Kasmir version, published in the
Abhandlungen of the Saxon Society, vol. XXII, 1904,
and that of Purnabhadra. The southern recension
has been edited by Haberlandt, Wien, 1884. Pischel.
Rudraia, p. 26, note 2, thinks it is not in every respect
older. But see Biihler, in Gough’s Records of Anc.
Sansk. Lit., p. 101, and Dr. J. Hertel’s arguments in
Z.D.M.G. , LVI-LIX.
Translation in German, Fritzc, 1884; Benfey, 1859,
with full introduction; in French, Lancereau, 1871.
Kielhorn and Buhler’s edition has many misprints.
Purnabhadra’s version is being critically edited for the
Harvard Oriental Series by Dr. Hertel, who will treat
of the date of the Pancatantra in his forthcoming
History of the Beast-Fable of India.
g 2
44
CATALOGUE OF
The text is bounded on either side by two red lines.
.Measurement of binding : io|-X 6- in.
No. of leaves: i+ 188 + iv blank. The three parts
in the original foliation fill ff. i—I47 j i 47 V—t 7 iV j
172—188 v . Arranged like a European book.
Date: none is given for this part, but it is by the
same hand as 326, 765.
336— MS. Wilson 240
Pancatantra, A. D. 1800.
Contents: the first 80 pages have been carefully
enough corrected by a recent hand, which has used
yellow pigment for the purpose.
Measurement of binding: 13^x6^ in.
No. of leaves: ii + 200 + ii blank.
Date: f. 200: samvat 1856 (=a. d. 1800) miti
kdtrkakrsnapakse pratipadaydm 1 vara aditavdra 1
337— MS. Wilson 244
Pancatantra, 10th cent.?
Contents: many translations and remarks are
written by Wilson on the margins.
Ff. 1, 2, 12, 22, 32, 42, 51, 102, 103 are on yellow
paper. _
Measurement of binding: i4jX6-|in.
No. of leaves : ii+103 (not 200)+ ii blank. In the
original foliation 101, as ff. 1, 103 are blank, and not
reckoned.
338— MS. Wilson 39 a
Hitopadesa, 19th cent.?
Contents: the date of the Hitopadesa cannot be
fixed with certainty. A MS. of a. d. 1373 from Nepal
exists. Cf. Lanman, Sanskrit Deader, p. 311. Peterson
once thought it was as old as the nth cent. Cf. Ben-
dall, Journey in Nepal, p. 55. There seems little doubt
that Narayana is the author, not the scribe merely.
Critically edited by P. Peterson, Bombay, 1887.
See also Hertel, Uber Text und Verfasser d. Hitopadesa,
Leipzig, 1897.
Measurement of binding : 16^ X 5L in.
Material: red or yellow country paper.
No. of leaves: ii+173+ii blank. The four parts in
the original foliation have 100 + 31 + 194-23 leaves.
339— MS. Walker 190°
Madhavanalakhyana, 18th cent.?
Contents : see on MS. Sansk. e. 54 (1097). Printed,
with a translation of the Prakrit passages, by P. E.
Pavolini, Stuttgart, 1893. The oldest MS. of any version
SANSKRIT MSS.
as yet known is dated a.d. 1530, Bendall, Brit. Mus.
catal.j p. 118, note 2. It is probably a work of the
14th cent.
The text, written by one hand in two styles, is
bounded on either side by a red line.
Measurement, fyc. ; this is part 3 of the MS. described
under 208.
340 — MS. Wilson 308c
Madhavanalakhyana, A. D. 1821.
Contents: the oldest MS. of this version seems to
be one of a. d. 1554, Bhandarkar, Deport, 1882, 1883,
p. 65, no. 155. -
Measurement, &;c.: this is part 3 of the MS. described
under 301.
Date: f.78: samvat 1877 ( = a.d. 1821) saumavdsare 1
Scribe: f. 78 : Parasuldla lisyate \
341 — MS. Wilson 426 h
S'akunyupakhyana and S'akataropakhy ana,
18th cent.?
Contents: katha 1 is on ff. 65 v -66 v ; 2, on ff. 67,
6y Y . Both are edited from a Bonn MS. with the aid
of a collation of this MS. and conjectures of R. C. S.
Keith and Prof. Jacobi, by Dr. J. Hertel in the
Z.D.M.G., LV, 487-494, 693-696. The tales are a
prose redaction of a verse original.
Measurement, fyc.: this is part 7 of the MS. described
under 661.
342 - 351 — MSS. Wilson 186-194
Mahabhasya, &c., 18th cent. ?
Contents: PatanjalPs date is still uncertain. It has
been held that he used a poetical grammar or grammars
(slokavarttikakara) which had ceased to be understood
in his time, and it is possible that the apparent
references to Menander and Pusyamitra were derived
from this source. Dr. Hoernle is inclined to date
him about the 2nd cent. a. d. Cf. Kielhorn, Kd-
tydyana and Patanjali, Bombay, 1876 ; Weber, Ind.
Stud., XIII, 293—502; Ind. Ant., XV, 81, 232 sq.,
XVI, 106. Bhandarkar, however, still maintains his
position, Ind. Ant., XVI, 156 sq., Hist. Deccan, 2 p. 140.
Cf. also Liebich, Panini, p. 15, against Kielhorn’s con¬
clusions from the use of bhagavan, Gott. Nachr., 1885.
Kaiyata is not quoted by any writer certainly
earlier than Madhava or Sayana (14th cent.), and both
Kielhorn and Biihler agree in thinking him late,
perhaps 13th cent. a. d., Biihler, Deport, p. 72 ;
Kielhorn, Patanjali, p. 12, note.
Nagojibhatta is assigned by Hall, Samkhyasdra,
p. 37, note, to a.d. 1713, which date is confirmed
APPENDIX TO VOL. I (335-355)
45
y Kielhorn and Bhandarkar’s results, Bhandarkar,
leport , 1883, 1884, p. 51.
Patanjali was edited by Kielhorn, Bombay, 1878—
883 (second edition of vol. 1,1892), and with Kaiyata,
Jenares, 1870 and 1887.
Panini’s date is still obscure. The word Yavanani
leed not point to a date after b.c. 300, for Gandhara sent
roops against Greece, and Greek coins of earlier date
lave been found in Afghanistan, Biihler, Palaeographies
3. 3; cf. Vienna Orient. Journ., XIII, and Schroeder,
Pythagoras und die Inder. On the question whether he
s the author of the Patalavijaya and Jambavatlvijaya,
see references in Pischel, Prakrit Grammar, p. 33.
The MS. was probably written by a good many
lifferent hands ; clearly distinct from the rest however
ire only (1) 180, ff. 153-238 ; (2) 180, ff. 245-352,
L03, ff. 149-369; (3) 102 and 104, ff. 1-100 in which
ilone the text is bounded on either side by three
louble red lines; (4) 186,188, ff. 1—212. 180, ff. 239-
244 have been recently supplied.
Measurement of binding: i2j X 6f in. approximately
or each volume.
No. of leaves:
186 = ii + 336 + ii blank.
188 = ii + 322 + ii blank.
187 = ii + 389 + ii blank.
188 = ii + 275 + ii blank.
180 = ii + 375 + ii blank.
100 = ii + 347 + ii blank.
101 = ii + 361 + ii blank.
102 = ii + 363 + ii blank.
103 = ii + 369 + ii blank.
104 = ii + 329 + ii blank.
Originally most of the ahnikas were foliated se¬
parately, but there is often as well a continuous
foliation, both being carelessly made.
Bates:
(1) 180, f. 58 : sam 1875 ( = A - D - 1819) I
(2) 188, f. i 87 v : sam 1516 (=a. d. 1460)1 If
this means anything it must refer to the date of an
archetype of Kaiyata.
(3) 180, f. 148: srisamvat 1843 (=a. d. 1787)
bhadramase krsim 15 vudhavasare I
(4) 101, f. 361 : srisamvat 1843 1
It does not seem possible to verify Benares or 1790
A. D.
352—MS. Wilson 283 a
S'abdakaustubha, A. D. 1810.
Contents: this work was left unfinished by the
author. Burnell, Tanjore catal., p. 39, mentions MSS.
of adhyayas 1-4; Mitra, Notices, IV, 66, one of
adhyayas 2-4. Most MSS. (e. g. Eggeling, India
Office catal., p. 163 ; Mitra, Cat. Gramm. MSS., p. 129,
Notices, VII, 130) contain only pada I of adhyaya 1.
Ff. 1, 9, 22, 29, 35, 45, 55, 61, 71, 82, 91, 101, hi,
118, 119, 125, 132, 139, 144, H7> i57> i6 3>
179, 185, 196, 197, 201, 206, 211, 218, 223, 226, 232,
233, 238, 239, 240, 247, 255, 262, 268, 276 are on
yellow paper. There are many later corrections.
Measurement of binding: 10jX in.
No. of leaves: ii + 376+ ii blank. In the original
foliation part 1 has 34 + 26 + 58 + 29+31 + 18+49
(really 43, as ff. 27-33 are on ty represented by a later
insertion of one leaf)+ 37 leaves. Part 2 has 26 + 24
+ 49 leaves (f. 376 is not counted).
Bate : f. 118 : sainvata 1875 ( = a. d. 1819) miti dsd°
suklapache punavrdsi 15 1
Scribe : f. 118 : iha pot hi Sukulajikd hai 1 vecanald-
Idkaethane lisa sdkinajamgamavarimorahatepaih \
353 — MS. Walker 208c
Jfiapakasamuccaya, 17th cent. P
Contents: the text is bounded on either side by
two double red lines. There are a good many correc¬
tions by a later hand, and yellow pigment is used for
them. ■..
Measurement, Syc.: this is part 3 of the MS. described
under 200.
354 — MS. Wilson 280 b
Paribhaaendu^ekhara, A. D. 1808.
Contents: edited with translations and explanations
by Kielhorn, Bomb. Sansk. Series, 1868-1874, an( ^
Benares, 1897 and 1898.
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 2 of the MS. described
under 387.
Bate: f. 253 : 1862 samvat ( = a. d. i8c6) i
355 — MS. Wilson 100
Vitthala on the Prakriyakaumudi, 17th cent. ?
Contents: for this work see Bhandarkar, Report,
1883, 1884, p. 59, who fixes its date at about a.d. 1500;
Eggeling, India Office catal., pp. 167 sq., where no. 619
claims to be (copied from) a MS. of samvat 1536
( = a. d. 1480) which, if not a slip, must have been the
archetype, as a great-grandson of Ramacandra’s lived in
a.d. 1527. See also Mitra, Cat. Gramm. MSS., p. 66.
The text is bounded on either side by two red lines.
Measurement of binding : i2^x 5-^ in.
CATALOGUE OF SANSKRIT MSS.
4C
No. of leaves: ii + 128 + ii blank. The original folia¬
tion makes 211, but ff. 44-126 are now lost.
Scribe: f. I2<S Y : sthitvd Vdrdnaslpwryydm sndtvd
pancanade ’imam I Prasddo ’yam subantasydnantena
likhitah slvatn 11 It is very probable that Ananta was
one of Ramacandra’s family, cf. Bhandarkar, /. c. 1 he
date may be about a. d. 1650.
35g_MS. Wilson 200
Praudhamanorama, 18th cent.?
Contents: the text was lithographed at Benares,
1868, 1872. The glosses are extracted—as may be
proved by comparison with MS. Sansk. d. 99 (1129)
—from Haridiksita’s Laghusabdaratna, a commentary
on his grandfather’s work, Mitra, Cat. Gramm. MSS.,
p. 80; Eggeling, India Office catal., p. 174; Mitra,
Notices, III, 312 ; Burnell, Tanjore catal., p. 40. There
are some similar extracts on ff. 88—92.
The Durghatavrttikrt cited is Saranadeva, a.d. 1479, j
Stein, Kasmtr catal., p. xx. j
The text is bounded on either side by two double
red lines.
Measurement of binding: 1 if x 6 in.
No. of leaves : ii + 203 + ii blank. Originally foliated
1-147 (really 148, f. 48 being repeated) and 125-179
leaves.
Character: traces of Kasmlrl influence. Cf. 366.
357—MS. Wilson 426 1
Praudhamanorama (1st part), 18th cent.?
Contents : this work is made up of two pieces, foliated
as (1) ff. 1—3, (2) ff. 2—35, which are however consecutive.
The text is bounded on either side by two red lines.
The MS. is much corrected by a late hand.
Measurement,8fc.: this is part 10 of the MS. described
under 551.
358 — MS. Wilson 320
Praudhamanorama (2nd part), 18th cent.?
Contents: on ff. 2-31 the text is usually bounded on
either side by two red lines.
Measurement of binding: 1 if- x 6 in.
No. of leaves : i + 81 + i blank.
359 —MS. Wilson 156
Praudhamanorama (3rd part), 19th cent.?
Measurement of binding: 14 X 6f in.
No. of leaves: H+ 115+ ii blank. The original foliation
has 88 + 27 leaves.
360 , 361 — MS. Wilson 281, 282
TattvabodhinI (1st part), 19th cent.?
Contents: see Eggeling, India Office catal., p. 173;
Aufrecht, Leipzig catal., p. 253 ; Mitra, Cat. Gramm.
MSS., p. 17 ; Burnell, Tanjore catal., p. 40.
Best edition, Nirnaya Sdgara press, with Jayakrsna’s
Subodhinl, 1899; also at Benares, 1897. The author
probably belongs to about a. d. i 700.
The text is bounded on either 'side by two double
red lines.
Measurement of binding : iof x in. approximately
for both volumes.
No. of leaves : 281 = ii + 218 + ii blank ; 282 = ii +
226 + ii blank. In the original foliation 133 -1- 311, f. 239
of the latter part being lost, and f. 196 repeated.
362 — MS. Wilson 199
Tattvabodhini (1st part^, 19th cent.?
Contents: ff. 39 <d v —39 i v contain an index of content s.
Measurement of binding: 1 if x 10 in.
Material: paper water-marked ‘ S. & C. Wise.’
No. of leaves: i + 391 + ii blank. Arranged like a
European book.
Late: the latest date in the water-mark is 1810.
363 - MS. Wilson 198
Tattvabodhini (2nd part), 19th cent.?
Contents: in both parts the text is bounded on
either side by two double red lines, and both parts
are written by the same hand.
Measurement of binding: i 2 f x6f in.
No. of leaves : ii + 296 + ii blank. The two parts
have 151 (really 153, as f. 74 is repeated, and f. 89
[the verso is blank] is passed over)+142 (really 143,
as f. 73 is repeated) leaves.
364 — MS. Wilson 197
Laghuiabdendu£ekhara, 18th cent.?
Contents: see Eggeling, India Office catal., pp. 176
(Brhat°), 177 sq. (Laghu 0 ); Mitra, Notices, II, 132;
Burnell, Tanjore catal., p. 40 ; Aufrecht, Leipzig catal.,
pp. 253, 254; and on MS. Sansk. d. 100 (1122).
Ff. 61-75 an d f- 46 are by different hands from the
rest. F. 21 i v is blank.
Measurement of binding : 12 ]- x 6f in.
APPENDIX TO VOL. I (355-370)
47
No. of leaves : ii + 393 + ii blank. The original foliation
lakes 245 (really 246, as f. 45 is repeated) + 147 leaves.
Date :
(1) If. 246 v : samvat 1818 ( = a. d. 1762) asadha-
uklapurnamasydm bhrguvdrdnvitdydm \
(2) f. 393 : samvat 69 margasuti I mdrgasisarama.se
iuklapakse dasamyam guruvdsardnvitdydm 1 There can
je little or no doubt that this is a Saptarsi date, and
herefore = (17)93 A - D * The on ^ other possibility is
:o make it 1669 saka = a. d. 1747*
Scribe:
(1) f. 246 v : likliitam idam Ganesamisrena l
(2) f. 393 : maya Kdsimrl (blank) likhitam\ These
notices present difficulties; from the handwriting one
would distinguish three main scribes : (1) ff*. i~95 ( ex “
eluding 61-75); (2) ff - 9 6 ~ 3 l 9 ‘> (3) ff - 3 I 9 V “393- 1 and
3 are distinctly Kasmlri hands, while 2 (Gaiiesamisra’s)
is ordinary Devanagari. But all three pieces look as
if they were of the same date, though it is perhaps
possible that 3 is as late as 1793 a. d.
365 — MS. Wilson 284
LaghusabdenduSekhara, 19th cent. ?
Contents: written by two hands: (i) ff. 1-403;
(2) ff. 404 to the end (in the original foliation).
In the latter part the text is bounded on either side
by three or four red lines.
Measurement of binding : 1X 6-7 in.
No. of leaves ; ii + 454 + ii blank. The original foliation
reckons 422 (really 355, ff. 1-9, 224, 265-321 being lost)
+ 44+29 + 26 leaves.
366 — MS. Wilson 195
Laghuiabdenduiekhara, 18th cent. ?
Contents: the title of the commentary is really
Cidasthimala, and the author’s name should be written
Payagunde. Cf. Eggeling, India Office catal., p. 178 ;
Mitra, Cat. Gramm. MSS., pp. 15, no. Notices, III,
319. The work must belong to about a. d. 1750.
On some leaves the text is bounded on either side
by two double red lines.
Measurement of binding: 13 j x 6-| in.
No. of leaves : ii + 230 + ii blank. In the original folia¬
tion 85 + 68 + 61 (really 51, as ff. 42-51 are lost)+ 26
leaves.
Scribe: probably three hands were employed: (1)
ff. 26-85; (2) ff. 154-204; (3) ff. 1-25, 86-153, 2 °5“
230 are perhaps by one hand, which shows marked
traces of Kasmlri influence.
367 — MS. Wilson 280 il
Madhyasiddhantakaumudi, A. D. 1794.
Contents: see Eggeling, India Office catal., p. 178;
Aufrecht, Leipzig catal., p. 255 ; Mitra, Cat. Gramm .
MSS., p. 93; Weber, Catal., I, 215, 216; Mitra, Notices,
VII, 272 ; Burnell, Tavjore catal., p. 40^; Bendall, Brit.
Mus. catal., p. 146. Varadaraja’s date can be fixed to
about a. d. 1650-1680, as his teacher BhattojTdiksita
flourished about a. d. 1631 (Bhandarkar, Report, 1883,
1884, p. 51), and Burnell mentions a MS. of a.d. 1693
(samv. 1749), Weber one of 1716, while Eggeling assigns
a MS. of the Laghukaumudi to about a. d. 1700 (p. 179).
Bendall assigns the work to the 16th cent., but even if
the earlier date (a. d. 1600) for BhattojTdiksita suggested
by him, p. 163, is accepted, this is too early.
Measurement of binding: io| x 5^ in.
No. of leaves: ii+ 309+ii blank. The three parts
in the original foliation have 203+50 + 56 leaves.
Date: f. 203: samvat 1850 ( = a. d. 1794) l miti
vaisakhavadi puranavdsi l lekhakabrahmanahargydna
Kdsimadhye Gamgdta'tidasdsumeramadhye Kapasydki
Brahmapurdmadhyc I A former owner is given on f. i :
om sridurlabhardmasyedam jmstakam Madhyakaumu-
dydh \
368 — MS. Walker 199
Madhyasiddhantakaumudi, 18th cent. ?
Contents: the old leaves have the text bounded on
either side by two red lines. A good many corrections
have been made by a later hand. F. 29 is partially ncw\
Measurement of binding : 9^ x 5^ in.
No. of leaves: ii + 127+ii blank. In the original
foliation there are 93 (really 90, as ff. 27-29 are lost) +
37 leaves.
. 369 — MS. Walker 137 d
Madhyasiddhantakaumudi, 18th cent. ?
Contents: the text is bounded on either side by
four red lines. Ff. 1, 5, 10, ti, 15 are missing.
Measurement, Sfc.: this is part 4 of the MS. described
under 708.
370 — MS. Wilson 147 a
Prabodhacandrika, 19th cent.?
Contents : see Weber, Catal., II, 202, 203, who reads
the name as Vaijala, no doubt correctly; Mitra, Notices,
VIII, 12 ; Aufrecht, Leipzig catal., p. 261; MS. Sansk.
e. 58 (1145). Perhaps the Hammira yuddhavira is the
famous prince of the Cahuvana race, king of S'akambharl,
who reigned probably from a. d. 1301-1365. Cf. also
Bhandarkar, Report, 1883, 1884, p. 57, who assigns
48
CATALOGUE OF
Vaijala to Candravati, now Jhalrapattan. Is the Vaijalla
of Ind. Antiq ., XVIII, 81 an ancestor?
Measurement of binding : i6f x 4^ in.
No. of leaves: i + 27+1 blank. The two parts in
the original foliation have 17+9 (really io, f. 6 being
repeated) leaves.
371— MS. Wilson 250 b
Lingavi^esavidhi, A. D. 1821.
Contents: Mitra, Notices, VI, 14, seems to be only
similar, not identical. _____
Measurement of binding : 14 X 6-| in.
No. of leaves : i + 39+ i blank. The two parts in
the original foliation have 22 (really 23, as f. 14 is
passed over)+ 16 leaves.
Bate: f. 22: samvat 1877 ( = a. d. 1821) nu° sra°
vri° 4 I
Scribe: parts 1 and 2 are by different hands.
372— MS. Wilson 201
Madhavlyadhatuvrtti, A.D. 1813.
Contents: Klemm, Gurupujbkaumudi, pp. 46, 47, has
suggested a new' meaning of Mfidhaviya, namely,
‘after the style of Madhava’ (Madhava used Jaiminlya
in an analogous manner), and this Madhava he takes
not to be Sayana’s brother, but the older Madhava
cited by Sayana, e. g. on Rg-veda X, 86 (cf. 017).
This view he applies to the llg-veda commentary only;
presumably it is not meant to be extended to this Vrtti.
Printed at Benares, 1897, reprint from the Pandit.
The colophon on f. 327 runs: iti purvadaksinapa-
scimasamudrddhisvarakampardjasutasamgamardijamahd-
mamtrina Mdyenaputrena Madhavasahodarena Sdyandi-
yaranaviracitdydm Madhaviyam dhdtuvrtau sastikarana
bhuvadayah sampurnam l Of Sangama II, son of
Kampa, son of Sangama I, w r e have a grant dated
a.d. 1356, Epigr. Ind., Ill, 24. Sayana was not, as
is usually said (Duff, Chronol. of India, p. 223), ever
abbot of Sfrngeri, and even Madhava was not abbot for
many years after a.d. 1331, and it w r as Madhava, not
Sayana, who died in a.d. 1387, as has been shown by
Klemm in his paper, /. c.
Measurement of binding : 11| x 10 in.
Material: paper w r ater-marked ‘Budget & Wilmott.’
No. of leaves: iii + 327 + i blank. Arranged like a
European book.
Bate: the year 1813 is deduced from a remark of
"Wilson’s on f. iii, where after translating the colophon
he writes ‘ 1813’ (?).
SANSKRIT MSS.
373— MS. Wilson 302
Dhatupatha Paniniya, A.D. 1755.
Contents: the pages are divided by red lines into
three columns. ______
Measurement of binding : 111X 8| in.
No. of leaves : ii + 134 + iii blank. It was originally
paged. Arranged like a European book.
Bate: f. I34 v : subhasamvata 1811 ( = a. d. 1755)1
This is clearly impossible, and the MS. is of the same
period and perhaps by the same hand as MS. Wilson
419 (1150). The date must be that of the archetype.
374— MS. Wilson 16
Katantra, 10th cent. P
Contents . Sarvavarman’s date is very doubtful.
Bhandarkar, Hist. Bercan,- p. 170, reports a tradition
which would assign him to about the 2nd cent. a. d.
Cf. also the Chinese ascription of alphabetical improve¬
ments to him or Nagarjuna, whose date is possibly
2nd cent., S. L€vi quoted in Biihler, Palaeographie, p.54.
Edited by Eggeling, Hibl. Ind., 1874-1878, with
Durgasimha’s commentary, and extracts from other
commentaries.
On the school—a Bauddha one—cf. Haraprasada,
Notices , I, pt. iii, pp. ii sq., pt. i, pp. 45 sq.
Measurement of binding : 11 * X 6 £ in.
No. of leaves: iii + 96 + ii blank. The strips of
palm-leaf are pasted by their edges to the leaves
of the MS.
375— MS. Wilson 147 b
Durgasimha on the Katantra, 10th cent.?
Contents: Durgasimha is cited by Hemacandra,
and therefore belongs probably to the 10th cent, at
latest, Kielhorn, Ind. Ant., XV, 182. Cf. on 377.
Measurement, fyc.: this is part 2 of the MS. described
under 370.
376— MS. Wilson 14
Durgasimha on the Katantra, A.D. 1814.
Contents: the MS. is fairly accurate.
Kept in a wooden box, with three compartments.
Size of box : i8| x 8^ X 2j in.
No. of leaves: Part I = ii + 99 + ii blank ; Part II =
i+103 +iv blank; Part III = ii + 112 + ii blank. In
each case two big outer leaves hold the MS. together,
with a string passing through a central hole.
Bate : Part II, f. 103: Sakatltabdah 1736 (a.d. 1804) l
APPENDIX TO VOL. I (370-382)
49
377_MS. Wilson 11
KatantravrttipaSjika, 18th and 19th cent. P
Contents: see Eggeling, Katantra, p. 466, India
Office cataL, pp. 198 sq.; Bendall, Brit. Mus. catal.,
). 148. Because of Vopadeva’s reference the work
nust be anterior to a. d. i 200, and it is posterior to
;he Nyasa of Jinendrabuddhi, about which, however,
nothing definite is known, save that it is anterior to
Vopadeva (cf. Biihler, Kasmir Report , p. 73). If indeed
Aufrecht, Catalogus Catalogorum , p. 103, were right
in supposing the Nyasa to be intended by Magha,
S'isupalavadha , II, 112, the Nyasa would belong to
the 7th cent, at latest, but this is almost certainly
wrong. ——t
Kept in a wooden box, with three compartments.
Measurement of box : 1 2 j X gf X 2 -f in.
No. of leaves: Part I = iv + 63 + ii blank; Part 11 =
i + 154 + i blank; Part III =150. The leaves are held
together by a string passing through a central hole.
378— MS. Walker 168 d
Haimadhatupatha, 17th cent.?
Contents : ff. 1, 2 have been replaced by a Jaina
fragment. *
The text is bounded on either side by four red lines,
and a red diagram is placed in the centre of each page.
On the verso in centre-margin are three large round
red spots.
Measurement, fyc.: this is part 4 of MS. Walker 168
(1596).
379— MS. Walker 101 b
Haimadhatupatha, A. D. 1770.
Contents: the text is arranged in three columns,
divided by two red lines, with three red lines on the
margin, and two at the top.
Measurement, fyc.: this is part 2 of the MS. described
under 497.
Bate: f. 82: samvat 1832 ( = a. d. 1766) phalguna-
sudi 15 kuje likhitam 1
Scribe : f. 82 : agnihotnvydsatulasi tasyatmajabhu-
devanamnavilikhito’yamdhaturganab \ svarthe pararthe
va l
Character: Jaina Devanagarl.
380— MS. Walker 108b
Vibhramasutra, 10th cent.?
Contents: another commentary was composed in
a. d. 1569 by Caritrasimha at Dhavalakkapura, Eggeling,
BODL. SANS. CATAL. APP.
India Office catal., p. 210. For this see Weber, Catal.,
II, 253, 254.
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 2 of MS. Walker 168
(1596).
Character: Jaina Devanagarl.
381— MS. Walker 201 f
Sarasvatlprakriya, 17th cent.?
Contents: on the Sarasvata, cf. Eggeling, India
Office catal., pp. 201-206; Mitra, Cat. Gramm. MSS.,
pp. 151 sq. Attributed by Aufrecht, Leipzig catal.,
p. 256, to Anubhutisvarupa himself. The date is quite
uncertain. Printed at Bombay, 1861 and 1895.
Ff. 79, 80 contain various scraps. The text is
bounded on either side by two black lines.
Measurement, fyc.: this is part 6 of the MS. described
under 610.
Date: on f. 79, which apparently belongs to this
part, appears : samvat 1835 (1) ( = a. d. 1779) na varase
phalguna vada 14 1 This may be the date of an owner.
Scribe : on f. 79 appears : pathakabapurama -
(all erased) l Possibly this is an owner.
382— MS. Walker 131*
Anubhutisvarupa on the Sarasvatlsutra, 18th cent. ?
Contents: see Aufrecht, Leipzig catal., pp. 258, 259.
The scholia are perhaps by the first hand. Yellow
pigment is used for corrections. The text is bounded
on either side by two or three red lines.
Measurement of binding: 11 X 6 -1 in.
No. of leaves: ii + 209 4- ii blank. The two parts in the
original foliation have 154(10 + 50 + 66 + 28) +561eaves.
Bate:
(1) f. io v : samvata 1829 ( = a. d. 17 J 3 )jethasuda
7 gurau \
(2) f. 6o v : samvat 1832 ( = a. d. 1776) margasir-
savadi 13 budhe \
(3) f. 126 v : samvat 1831 (a. d. 1775) var ? e vaisd-
sasudi 15 some l
(4) f. I54 v has the date of the original; on f. 154
appears : samvat 1831 jyestamdi 2 b'icamdravdsare \
Scribe:
(1) f. io v : pathandrthamVyasasn 5 bhudeva \
(2) f. 6o v : agnihotrivyasatulasi tasyatmajabhu-
devanamna vilikhivasti I So f. 126 v with sri 5 after
vydsa° ; and f. 154 ( atmajena ).
Character: Jaina Devanagarl.
H
50
CATALOGUE OF SANSKRIT MSS.
3Q3—MS. Wilson 285
Sarasvatiprakriya, 18th cent.?
Contents: ff. 1-34 are by one hand, the remainder
by another. There are numerous corrections apparently
by Wilson himself. _______
Measurement of binding: X in.
No. of leaves: iii + 96 + iv blank. The original foliation
makes 34 + 62 leaves. Arranged like a European book.
384-MS. Walker 191*
Sarasvatiprakriya, 17th cent.?
Contents: the first three leaves of the original MS.
have been lost, and their place is filled by three new
leaves, the first two of which have only scribbling on
the recto, ff. i v , 2 V .
The text is bounded on either side by two red lines.
It has been much corrected by a later hand. Ff. 9,
io are supplied, but seem to be early.
Measurement of binding : 8| X 6| in.
No. of leaves : ii+ 150 + ii blank. The three parts
which make up the volume have 55 + 8 + 87 (really 85,
ff. 44, 45 being lost) leaves.
Scribe: his name or perhaps an owner’s appears
to have been added (possibly by a later, but still old
hand) on f. 55 v , but the notice has been partially lost:
what remains runs: pdthakakrsnarammagovamdya-
rdmmanu Sarasvatache pbithakapusavardmmagovamda-
rdmmaja -I
Injuries: a good many leaves are torn, especially
at the edges.
385— MS. Wilson 286
Sarasvatiprakriya, 19th cent. ?
Contents: on f. 25 v , 11. 2-9 are repeated from the
preceding page ; so f. 29, 11. 5—9.
Measurement of binding : nf X7 in.
Material: paper water-marked ‘Balston & Co./ or
‘ Whatman/ or 1 Snclgrove.’
No. of leaves: ii 4- 62 + ii blank. The original foliation
makes 63, but there is no f. 13.
Bate: the latest date in the water-mark is 1831, on f. 7.
386— MS. Walker 179®
Siddhantacandrika, A. D. 1776.
Contents: cf. Eggeling, India Office catal., p.216;
Mitra, Notices, IX, 34, Cat. Gramm. MSS., p. 154.
Printed, with Sadananda’s commentary, at Benares,
1864, Bombay, 1881 and 1890. Sadananda wrote pos¬
sibly in a. d. 1778 (or 1644), Aufrecht, Leipzig catal,
p. 258. Ramacandra is later than Anubhutisvarupa.
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 5 of the MS. described
under 179.
Date: f. 229 v : samvat 1832 ( = a.d. 1776) bhadravdvd
13 bhrgau likhitam 1
Scribe: f. 229 v : agnihotrlvyasasri 5 tulasi tasydtma-
jena Bhudevandmna vilikhitam asti 1
Character: Jaina Devanagari.
387— MS. Wilson 283 b
Siddhantacandrika, 18th and (f. 376) 19th cent. ?
Contents: this MS. has been written by two hands:
(1) ff. 277~302 v in a hand of about a.d. 1720-1750,
text bounded on either side by two red lines; (2)
ff. 303~374 v . F. 375 is quite modern.
Measurement, §c.: this is part 2 of the MS. described
under 352.
388— MS. Wilson 17 ,
Samksiptasara, 19th cent. ?
Contents: on the Jaumara system see Zachariae,
Bezz.Beitr., V,22sq.; Mitra, Ca/. Gramm.MSS., pp. 135,
136. This school seems to be older than Vopadeva
(a. d. 1250). Cf. Eggeling, India Office catal., pp. 218 sq.;
Haraprasada, Notices, I, pt. iii, pp. vi sq. ; Pischel,
Prakrit Grammar, pp. 40, 41. The oldest author cited
is Murari. _
Measurement of binding: 15^ x 5^ in.
Material: yellow country paper.
No. of leaves: ii + 198 + ii blank. The original foliation
makes 21 + 42 + 26 + 39 + 15 + 22 + 33 leaves.
389— MS. Wilson 148
Goyicandra on the Samksiptasara, 19th cent. ?
Contents: see Eggeling, India Office catal., pp. 218 sq.;
Mitra, Cat. Gramm. MSS., pp. 136, 137. On f. 1 the
slokasamkhya is given as 2384. Goyicandra is at
least anterior to 1600, since he is quoted by Durgadasa,
Bodl. catal., p. 175.
Measurement of binding : 15^ x 4^ in.
Material: yellow country paper.
No. of leaves: ii +91 + ii blank.
Bate: very possibly about 1830 from the similarity
of this MS. to 690, &c.
APPENDIX TO VOL. I (383-399)
51
390-ms. Wilson 14 0 a
Goylcandra on the Samksiptasara,
A.D. 1827 and 18th cent.?
Contents: in the old part, ff. 8-24, there is a blank
square in the centre of each page.
Measurement of binding: 16^x4! in.
Material: yellow country paper for the new part.
No. of leaves : ii + 279 + ii blank. The three parts
in the original foliation have 134 (really 139, as the
numbering'is 1-7, 4-134, of which f. 65 is repeated)
+ 78+(20+ 42) leaves.
Date: cf. 302.
Scribe:
(1) f. I39 v : svaksaran ca pustakam idarn Srlka-
sinathadevasarmmanab I
(2) f. 217: srikasindthadevasarmmd \
391— MS. Wilson 146
Goyicandra on the Samksiptasara, A.D. 1703.
Contents: in ff. 2—68 there is a blank square in the
centre of each page. __
Measurement of binding : 15IX 4^ in.
No. of leaves: ii + 137 + ii blank. The original folia¬
tion has 1+67 + 69 leaves.
Date: that on f. 68 is not very legible, but panca-
vimsa ('{) sodasasatasakabde is still visible ( = a. d. 1703).
Scribe:
(1) f. 68 : snvrndavanasarmmano lipir esa 1
(2) f. I37 v : srikasindthadevasarmmanali saksara-
pustakam idarn \
392— MS. Wilson 13
Goyicandra on the Samksiptasara, A. D. 1827.
Contents: a few corrections have been made,
apparently by the first hand.
Measurement of binding : 19J x 4J in.
Material: yellow country paper.
No. of leaves: ii + 70 + ii blank. The original foliation
makes 71 ff., but f. 55 is missing.
Date: f. 70 : sakabda 1749 ( = a. d. 1827 ) [
393— MS. Wilson 140 b
Jumaranandin’s Rasavati, 18th cent.?
Contents: in the centre of each page is a blank
square. Ff. 238-279 and ff. 280 to the end are written
by different hands. _____
Measurement, fyc. : this is part 2 of the MS. described
under 300.
394—MS. Wilson 16
Mugdhabodha, 10th cent. ?
Contents: Vopadeva’s school is practically confined
to Bengal. For his date see on MS.Sansk.d.22o(1602).
Measurement of binding : i6|- x in.
Material: paper coloured brown.
No. of leaves : ii + 105 + ii blank.
395, 396— MSS. Wilson 18, 10
Durgadasa’s Subodha, 10th cent.?
Contents: in a. d. 1639 (not a.d. 1659) Durgadasa
wrote a commentary on Yopadeva’s Kavikalpadruma,
Eggeling, India Office catal., p. 240. For this work
cf. Eggeling, p. 231 ; popular only in Bengal, Mitra,
Notices, I, 254.
Measurement of binding : 16|- X 5|- in. approximately
for both volumes.
Material: yellow country paper.
No. of leaves:
18 = ii + 215 + ii blank. The original foliation has
214, as it does not count a half-filled leaf, f. 76.
10 = ii + 2i6+ii blank.
397— MS. Wilson 166
Kavikalpadruma, 10th cent.?
Contents: see Eggeling, India Office catal., p. 239 ;
Westergaard, Radices, p. v; Aufrecht, Leipzig catal.,
p. 260.
The roots are marked off by small lines above the
text.
Measurement of binding : 14IX 5 in.
Material : yellow country paper.
No. of leaves : i + 34 + i blank.
398— MS. Wilson 160
Kavyakamadhenu, 10th cent. ?
Contents: see Eggeling, India Office catal., p. 239 ;
Mitra, Notices, II, 194. There seems to be not the
slightest reason to question the authorship of Yopadeva
himself. Cf. Westergaard, Radices, p. v; Max Miiller,
Rgveda, 2 IY, cxxxiii.
Measurement of binding : 17 x^ in.
Material: yellow country paper.
No. of leaves: i + 30+ i blank.
399— MS. Wilson 410 a
Unadiko£a, 10th cent.?
Contents : cf. Mitra, Notices, II, 24. Ramatarkava-
H 2
CATALOGUE OF SANSKRIT MSS.
gisa and a fortiori Ramasarman arc anterior to Durga-
dusa (a. d. 1639), Bodl. catal., p. 175.
Measurement of binding : 1 if x 9^ in.
Material: paper water-marked ‘ J. Whatman.*
No. of leaves: i+109 +ii blank. In the original
foliation the two parts have 67 and 28 + 13 leaves.
Bate: the latest date in the water-mark is 1804.
400 —MS. Wilson 251
Unadikosa, 10th cent. P
Contents : the words are usually separated by small
lines at the top.
Measurement of binding: 12f x 4^ in.
Material: yellow country paper.
No. of leaves: ii + 55 + ii blank.
401 —MS. Wilson 12
Supadma, A. D. 1828.
Contents: Padmanabha’s date is probably about
a. d. 1500-1550. Aufrecht, Catalogus Catalogorum,
p. 534 a , takes 1480 as Rupanarayana’s date, but this
would put back Padmanabha’s date too far. The earlier
date is confirmed by the fact that all the MSS. of
the Saupadma school are modem Bengali. Eggeling,
India Office catal., p. 243, therefore is right in reading
Rupa’s date {sake prthvikhabdhiviyanmite ) as a. d. 1780.
The Rupanarayana in Aufrecht, l. c., II, 126, is probably
different, and Haraprasada, Notices, I a pt. iii, p. vii,
gives his date as a. d. 1375.
In the centre of each page is the usual square
blank space.
Measurement of binding: 21 X5f in.
No. of leaves: ii + 133 + ii blank. The original folia¬
tion makes 136, but ff. 99, 109, 128 are missing.
Bate: f. 133 v : sakdbda 12 saya 35 sal 0 sak 1650
(sic) 1 This should be 1750 ( = a.d. 1828) to agree
with 1235 of the Bengal era.
402—MS. Wilson 280°
Vaiyakaranabhusanasara, 10th cent.?
Contents: for this abridgement of the Vaiyakarana-
siddhantabhusana, see Eggeling, India Office catal.,
p. 188; Mitra, Cat. Gramm. MSS., p. 117, Bikaner
catal., pp. 275 sq.; Aufrecht, Leipzig catal., pp. 255,
256. Published with Harivallabha’s commentary,
Benares, 1886. The author’s date must be about
a. d. 1660; called ‘ Kaunda’ on f. 309.
The text is bounded on either side by three red lines,
and many of the leaves are coloured red.
Measurement, 8fc.: this is part 3 of the MS. described
under 367.
403—MS. Walker 170
Vaiyakaranasiddhantamanjusa, 18th cent. ?
Contents: see Eggeling, India Office catal., p. 190;
Mitra, Notices, II, 164. Printed at Benares, 1875. Cf.
Aufrecht, Catalogus Catalogorum, p. 614, as to ‘ Laghu.’
Ff. 1, 21, 50, 56, 81, 87, 196, 202, 208, 222, 230,
237, 244, 254, 259, 264, 268, 272, 276, 280, 284, 288,
292, 299, 305, 311, 317, 3 2 3> 3 28 , 33 2 > 33 h 343 are
of yellow paper. The text is bounded on either side
by two red lines. Three hands must be distinguished:
(1) ff. 1-55, (2) ff. 55 v - 87 v , (3) ^ 88-343.
Measurement of binding : iof X 5f in.
No. of leaves : ii + 343 + ii blank.
404—MS. Wilson 157
Manjusakuncika,
ff. 1-06, A. D. 1700-1800, the rest 10th cent. ?
Contents: see Mitra, Cat. Gramm. MSS., p. 123,
Notices, VII, 78. The author treats also of the identity
of sabda and brahma. His date must be about
a. d. 1750. A list of his works, mainly logical, is
given in Aufrecht, Catalogus Catalogorum, pp. 121, 122.
Measurement of binding : I3j X 6f in.
No. of leaves : ii + 135 + ii blank.
405-413
For Addenda see Prakrit Catalogue.
414 —MS. Wilson 250
Nanarthakosa, 10th cent. P
Contents: see on Sasvata’s position in Sanskrit
lexicography, Zachariae, Die indischen Worterbucher,
р. 24, and his edition, Berlin, 1882, pp. xvii sq.
Ff. 1-20 are written by one hand, ff. 20 v ~34 by
another. ____
Measurement of binding: 13^- X in.
No. of leaves : i + 34 + i blank.
415, 416 —MSS. Wilson 412, 413
NamalinganuSasana and Vyakhyasudha,
after A. D. 1820.
Contents: for Bhattoji’s date see on MS. Sansk.
с. 79 (1614), and cf. Bendall, Brit. Mus. catal., p. 163.
Bhanuji quotes Rayamukuta (a.d. 1431), Bodl. catal.,
APPENDIX TO VOL. I (399-424)
53
i. 182. Amara 5 s date is very uncertain, Huth, Bie
Zeit des Kalidasa , pp. 17 sq.; Zachariae, l.c., pp. 18,19.
loernle, J.R.A. S., 1906, p. 941, assigns him, on very
loubtful grounds, to between a. d. 625 and 950.
The text occupies the centre, the commentary the
op and bottom, of each page. On either side the
;ext is bounded by two red lines.
Best edition, with Mahesvara’s commentary, by
Cintamani Sastrin Thatte, under Kielhorn 5 s super¬
intendence, Bombay, 1877, ed. 5, 1896. This com¬
mentary has been edited by Sfivadatta, Bombay, 1889.
Measurement of binding: 11-jX gf- in. approximately
for both volumes.
Material: paper water-marked 4 S. & C. Wise, 5 or
4 Budgen & Wilmott. 5
No. of leaves: 412 = ii +270 + ii blank; 413 = i +
220 +i blank. In the original foliation there are 490,
the leaves being numbered consecutively. Arranged
like a European book.
Bate: the latest date in the water-mark is 1810.
Scribe: probably identical with that of 428 , &c.
417— MS. Wilson 176
Namalinganu&asana, A. D. 1809.
Measurement of binding : i6j X 5^ in.
Material: yellow country paper.
No. of leaves : ii + 107 +ii blank. The original folia¬
tion makes 106, f. 12 being repeated.
Bate: f. 107: Sakabdah 1731 ( = a.d. 1809) I lipir
esd bahulasya pahcamadivasiyeti \
418— MS. Wilson 314“
Namalinganuiasana, after A. D. 1811.
Measurement of binding : io-| x 8-1 in.
Material: paper water-marked 4 J. Whatman. 5
No. of leaves: i+132 +iii blank. The two parts
have 72 (numbered as 134 pages incorrectly) + 60
leaves. Arranged like a European book.
Bate: the latest date in the water-mark seems to be
1811.
419— MS. Wilson 408 a
Namalinganu£asana, 19th cent.?
Measurement of binding: i2|- X 6 in.
No. of leaves : ii + 93 + ii blank. In the original folia¬
tion the two parts have 74+19 leaves.
420— MS. Walker 200 e
Namalinganu^asana, A. D. 1775.
Contents: the text is bounded on either side by
three red lines. —
Measurement , 8 fc.: this is part 7 of the MS. described
under 180 .
Bate: f. 239 (apparently in a later hand): samvat
1832 sake 1697 (= a. d. 1775) pra° jyes(hamase sukla-
pakse 7 saptami camdradine I
Scribe: f. 239: likhitam agnihotnvyasatulasisuta-
bhudevapathanartham l
Character: Jaina Devanagari.
421— MS. Wilson 415 c
Abhidhanaratnamala, A. D. 1820.
Contents:, cf. Eggeling, India Office catal., p. 281.
Heller, Kavirahasya, 1894, pp. 20 sq., has shown that
Halayudha lived in the 10th century, writing first the
lexicon, then the Kavirahasya (a. d. 950), then the
Mrtasamjivani under Muhja ; cf. Zachariae, l. c ., p. 26.
Edited by Aufrecht, London, 1861.
Measurement, fyc.: this is part 3 of the MS. described
under 428 .
422— MS. Wilson 404
Abhidhanacintamani, with commentary,
A.d! 1095.
Contents : the text is bounded on either side by two
red lines bordering one yellow; and small ornaments
are drawn round the numbers of the leaves.
Measurement of binding: io|x5|-in.
No. of leaves : ii + 201 + ii blank.
423— MS. Walker 205 e
Abhidhanacintamani, A. D. 1098.
Contents: see on MS. Sansk. d. 112 ( 1107 );
Zachariae, l. c., pp. 31—33. This commentary was one
of Hemacandra 5 s last works.
The text is bounded on either side by two red lines.
Edited by Ram Das Sen, Calcutta, 1878, and in
Abhidhanasamgraha, II.
Measurement (of binding ), Sfc.: this is part 7 of the
MS. described under 238 .
Bate: f. 202: samvat 1755 varse sake 1620 ( = a. d.
1698) pravarttamane maghamase suklapakse 2 tithau
camdravasare I
Character: Jaina Devanagari.
424— MS. Wilson 252
Abhidhanacintamani, A.D. 1812.
Contents: the MS. is very prettily written, the
text with interlinear glosses occupying the centre, the
commentary the top and bottom, of each page.
Measurement of binding : 12x9^ in.
54 CATALOGUE OF
No. of leaves: v + 89 + i blank! Originally paged
from 1 to 176, as f. i v = p. 1, and f. 89^ is blank. The
leaves are arranged as in a European book.
Date: f. 89: samvat 1869 Sake 1734 ( = a.d. 1812)
budhavare bamgalatarlka aganakl 12 amgaraijltarlka 25 I
425— MS. Wilson 403
Abhidhanacintamani, A. D. 1790.
Contents: Book III has 596*- stanzas; Book IV
has 422 stanzas.
The text is bounded on all four sides by an elaborate
margin of red and yellow lines.
Measurement of binding : 8-j X 4^ in.
No. of leaves : ii + 110 + iii blank.
426— MS. Walker 151*
Brhadabhidhanacintamani, A. D. 1802.
Contents: the text is bounded on either side by
a broad red line over three narrow lines.
Measurement, Sfc.: this is part 1 of MS. Walker 151
(1286).
Date: f. 106: samvat 1859 na varse sdkem 1724
( = a.d. 1802) pravarttamamye bhadrapadamase krsna-
pakse dvadasitithau sribudhavasare \
Scribe: f. 106 : lisitam Modhajiidtiyacdturavedijdni-
vdndbhdikdmnajlana I
427— MS. Wilson “253 >>
Nanarthasamgraha, A. D. 1820.
Contents: Ajayapala is cited in Ganaratnamahodadhi,
p. 183, 17, and so is anterior to a. d. 1140. The MSS.
extant are so corrupt as hardly to allow of an edition
being prepared, Zachariae, l. c., pp. 25, 26, Beitr. zu
Ind. Lex., pp. 13 sq.
Measurement, Sfc.: this is part 2 of the MS. described
under 430 .
428— MS. Wilson 415 a
VisvaprakaSa, not before A. D. 1820.
Contents: see Eggeling, India Office catal., p. 282.
Printed by Anundoram Borooah, 1884, and to be edited
in vol. Ill of the Abhidhanasamgraha, Zachariae, l.c.,
p. 29 .
The text is bounded on either side by two red lines.
Measurement of binding : 11-| x 9^ in.
Material: paper water-marked ‘ J. Whatman/
No. of leaves: i+166 + ii blank. In the original
foliation the three parts have 90 ( + 3 blank) +43
(+ 2 blank) + 28 leaves.
SANSKRIT MSS.
Date : the latest date in the water-mark is 1804. All
the parts are of the same date.
Scribe .- identical with that of 415 , 410 .
429— MS. Wilson 249*1
S'abdabhedaprakafia, after A. D. 1810.
Contents: see Eggeling, India Office catal., p. 294
(43 verses); Mitra, Notices , I, 118, VI, 298 (ascribed
to Purusottamadeva); printed as this author’s work in
the Dvadasakosasamgraha, Benares, 1865 (56 verses).
Cf. Zachariae, l.c., p. 29 ad fin.; Bendall, Brit. Mus.
catal., p. 164; and on MS. Sansk. d. 124 (1100).
In the centre of each page is a square blank space,
with a small hole in the centre.
Measurement of binding : 14 X 4^ in.
Material : yellow country paper.
No. of leaves : ii + 20+ ii blank. Ff. 1-4 contain
part 1; ff. 5—10, part 2; ff. io v -i2, part 3 ; ff. 13-
15, part 4; ff. 16-20, part 5; each having its own
foliation.
Date : f. 15 : sake ’ gnidirghdsyasadekamane pustam
svapdthdya lilekha yatndt \ natvd mahadevapaddravim-
dam ko ’pi dvtjah Sabdabhedaprakdsam 11 This is ex¬
plained in the margin: sakdbddh 1683 ( = a. d. 1761)1
This proves that this MS. is, with India Office 1334“,
a transcript from one original. How the Bodl. catal.
gets ‘post annum 1810’ is not clear, biit it must be
approximately correct.
430— MS. Wilson 393 1 ’
S'abdabhedaprakasa, after A. D. 1820.
Measurement, Sfc. : this is part 2 (ff. i v -2 v ) of the
MS. described under 310 . Index (referring to page
and line), ff. i~4 v .
431— MS. Wilson 240*
Ekaksarakosa, after A. D. 1810.
Contents: see MS. Sansk. d. 114 (1114) and reff.; also
Aufrecht, Cambr. catal., p. 18 ; Mitra, Notices, II, 337,
VIII, 101. The MSS. appear to differ considerably
as to the number of verses. Printed in Abhidhana¬
samgraha, I, no. 4. Cf. Zachariae, l. c., p. 38, and for
Purusottama, whose date is quite uncertain, p. 23.
His Trikandasesa is quoted in Rayamukuta (a. d. 1431),
Z.D.M.G., XXVIII, 113.
Measurement, fyc.: this is part 1 of the MS. described
under 429 .
APPENDIX TO VOL. I (424-441)
55
432— MS. Wilson 803 d
EkaksarakoSa, after A. D. 1810.
Measurement, 8fc.: this is part 2 (if. 5-6) of the
IS. described under 310 . Index, f. 11.
433— MS. Wilson 834
Kalpadru, A. D. 1821.
Contents: cf. Weber, Catal., I, 225 ; Burnell, Tanjore
'atal., p. 48L Cited by Dinakara (a. d. 1385), Zachariae,
'. c., p. 36, correcting the preface to the Nirnaya
Sagara edition of the Kiratarjuniya, p. 2.
Measurement of binding: 14 X 7 in.
No. of leaves : iii + 175 + ii blank.
Date: sam 1877 ( = a. d. 1821)1
434— MS. Wilson 611
Abhidh&natantra, 10th cent. P
Contents: see Eggeling, India Office catal., p. 287 ;
Mitra, Notices , II, 44. Catigrama is Chittagong in
Bengal, Zachariae, /. c., p. 37.
Measurement of binding : iof X 8 in.
Material: yellow country paper.
No. of leaves : i+228+ i blank. Arranged like a
European book.
435— MS. Wilson 40 0“
Bhuriprayoga, after A. D. 1820.
Contents : the author is quoted by Narayanasarman
(a.d. 1619) and Ramanatha (a. d. 1633), Aufrecht,
Catalogue Catalogorum, p. 415. Cf. Mitra, Notices,
II, 6 ; Zachariae, l. c., pp. 22, 37.
Measurement of binding : 1 ij x 9^ in.
Material: paper water-marked ( J. Whatman.’
No. of leaves : iv + 95 + v blank. The two parts in
the original foliation have 52 + 43 leaves. Arranged
like a European book.
Date: the water-mark is dated 1804, but the writing
is very recent.
436— MS. Wilson 414“
Bhuriprayoga, A.D. 1804.
Measurement of binding: 11 ^ x 9 in.
No. of leaves : ii +291+i blank. The original folia¬
tion has 2T9 (really 218, as f. 1 is lost)+ 73 leaves, the
first two parts being numbered consecutively. Arranged
like a European book.
Date: contemporaneous with 440 .
437— MS. Wilson 414°
S'abdamala, A.D. 1804.
Contents: see Mitra, Notices, II, 7.
Measurement, fyc.: this is part 2 of the MS. described
under 480 .
Date : as for 440 .
438— MS. Wilson 400 k
S'abdamala, after A.D. 1820.
Contents: Aufrecht, Catalogus Catalogomm, p. 526,
seems to withdraw his conjecture about the identity
of the author. -
Measurement, fyc.: this is part 2 of the MS. described
under 436 .
439— MS. Wilson 263“
S'abdaratn&vali, part 1, after A. D. 1820.
Contents : see Eggeling, India ^Office catal., pp. 286,
287; it looks as if this MS. were a copy of the India
Office MS. 1585 or 1512. Cf. Mitra, Notices, I, 200,
III, 65 ; Borooah, Ndnartliasamgraha , preface, p. 36.
The text is bounded on either side by two red lines.
Measurement of binding : 12* X 10 in.
Material: the paper is water-marked in part
‘ J. Whatman/ in part ( Budgen & Wilmott.’
No. of leaves : ii + 111 + ii blank. The original folia¬
tion is in two parts, which have 86 (+1 blank) +24
leaves. Arranged like a European book.
Date : the latest date in the water-mark is 1809.
440— MS. Wilson 414 b
S'abdaratnavali, part 2, A. D. 1804.
Measurement, Sfc.: this is part 2 of the MS. described
under 430 .
Date: f. 218: sake 1726 samvat 1861 ( = a.d. 1804)1
441— MS. Wilson 417
Nanartharatnamala, 10th cent. P
Contents: the author’s name is Irugapa Dandadhi-
natha or Bhaskara, Aufrecht, Catalogus Catalogorum,
p. 59. A Vijayanagara inscription shows him as a Jaina
general of Harihari II, a. d. 1385, Arch. Surv. South
Ind., Ill, 156. Stein’s Jammu MS. gives the name
as Nirupama, Kasmir catal., p. xxii; cf. Burnell,
Tanjore catal., p. 49 ; Zachariae, l. c., p. 36.
Measurement of binding: iof x 8f in.
No. of leaves : i + 70 + i blank.
CATALOGUE OF SANSKRIT MSS.
50
442— MS. Wilson 415 b
Nanartharatnamala, after A. D. 1810.
Contents : most of the numerous lacunae in MS.
Wilson 417 ( 441 ) are faithfully reproduced.
Measurement, fyc.: this is part 2 of the MS. described
under 428 .
443— MS. Wilson 314 1>
Nanartharatnamala, after A. D. 1811.
Measurement, fyc.: this is part 2 of the MS. described
under 418 .
Scribe: not by the same hand as 418 .
444— MS. Wilson 256 b
Asalatiprakaia, A. D. 1821.
Contents: the separate words in each line are
marked off by red strokes above the line. The text
is bounded on either side by two double red lines.
On f. 23 the work is described as Rasalakosa.
Measurement, fyc.: this is part 2 of the MS. described
under 371 .
Date: f. 39: samvat 1877 ( = a.d. 1821) srdvana-
krsna 6 ravivdsare \
445— MS. Wilson 249 b
NanarthadhvanimaSjari, 19th cent.?
Contents: see Eggeling, India Office catal., p. 291
(attributed to Durgasimha); Mitra, Notices, II, 155
(to Gadasimha). Cf. also Eggeling, p. 292 (76 stanzas).
Measurement, fyc.: this is part 2 of the MS. described
under 429 .
446— MS. Wilson 393*
Nanarthadhvanimafljarl, 19th cent. ?
Measurement, fyc . .• this is part 2 (ff. 6—8) of the
MS. described under 316 . Index, f. 12.
447 — MS. Wilson 249°
Dvirupakosa, fragment, after A. D. 1810.
Contents: f. 12 is in a quite different hand from
the rest of the MS.
Measurement, fyc.: this is part 3 of the MS. described
under 429 .
448— MS. Wilson 393 f
Dvirupakosa, after A. D. 1810.
Contents: a later hand has numbered the 60 verses,
partly in English numerals.
Measurement, fyc.: this is part 2 (ff. 8-g v ) of the
MS. described under 316 . Index, ff. 12 V — 17 V .
449— MS. Wilson 249e
Dvirupakosa, after A. D. 1810.
Contents: see Eggeling, India Office catal., p. 294,
where the work is attributed to Purusottama. Printed
in Dvadasakosasamgraha, and in Abhidhanasamgraha,
Bombay, I, no. 5. The former contains 55-7 verses
only, Zachariae, l. c., p. 38.
Measurement, fyc.: this is part 5 of the MS. described
under 429 .
450— MS. Wilson 393c
Dvirupakosa, after A. D. 1810.
Measurement, fyc. : this is part 2 (ff. 2 V ~4 V ) of the
MS. described under 316 . Index, ff. 4 v -n.
451— MS. Walker 181*
Dhanvantarlya Nighantu, A. D. 1467.
Contents: cf.Eggeling, India Office catal., pp. 973 sq.;
Aufrecht, Leipzig catal., p. 385. Kslrasvamin says it
is older than Amara, Zachariae, l. c., p. 38.
The text is bounded on either side by two double
red lines. In the centre of each page is the usual
blank space of the Jaina MSS. The gramthagra is
given at 1060*
Printed in the Anandasrama Series, 1896.
Measurement, fyc.: this is part z of MS. Walker 181
(1046).
Date: f. 139: samvat 1523 (=a. d. 1467) samaye
phalgunasudicaturthi ravivdsare I
Scribe : f. 139 : lilisitam pustaka Nalha l Ganapati-
prasadat \
Character: Jaina Devanagari.
452 —MS. Wilson 408 b
S'ivakoSa, A. D. 1820.
Contents : a commentary by the author exists, Stein,
Kasmir catal., p. 54. The date would suit well enough
the view that S'ivadatta’s father was the client of
Sayasta Khan (about a. d. 1658), cf. Stein, p. xxxv.
The text is bounded on either side by two or three
APPENDIX TO VOL. I (442-466)
57
fed lines. Ff. 77 v , 80 are left blank to receive the
nissing verses. Ff. 80, 87 are of yellow paper.
Measurement, fyc.: this is part 2 of the MS. described
mder 410 .
Date: f. 93: sammvata 1876 ( = a.d. 1820) masa-
mlvanakrsnatithltrayodasl camdravasare I
Scribe: f. 93 : likhitam Mohanarama brahmana \
453— MS. Wilson 410 b
S'abdacandrika, after A. D. 1820.
Contents : see Eggeling, India Office catal., p. 974;
Mitra, Notices , II, 25.
Measurement, fyc.: this is part 2 of the MS. described
under 390 .
454— MS. Wilson 416
Anekarthasamgraha, after A. D. 1810.
Contents: this MS. is probably an autograph.
Measurement of binding : 10J X 8 in.
Material: yellow country paper.
No. of leaves: i + 368 + i blank. Arranged like
a European book.
455— MS. Wilson 50
S'abdarthakalpataru, A. D. 1812.
Contents : ff. 10-19 are blank. There are occasional
transcriptions of the Sanskrit words into Telugu and
explanations. ______
Measurement of binding : 17j X ii£ in.
No. of leaves : iii + 570 + ii blank.
Late: the paper is European, and is water-marked
‘T. Stains/ or f S. Wise & Patch/ with the dates
1802 and 1806.
456— MS. Wilson 53
Index to words in TJnadikosa, Abhidhanacinta-
mani, &c., A. D. 1812.
Measurement of bindings: 16- X 11 in.
Ao. of leaves: ii + 369+ i blank. Arranged like
a European book.
Date: see a note by Wilson on f. 326.
457-461
See Addenda in Prakrit Catalogue.
462— MS. Walker 179 *
Vrttaratnakara, A.D. 1770 .
Contents: often edited in India,e.g. by Anundoram
Borooah, 1882. Translated in Pandit , O. S., vol. IX.
Anterior to the Rasikapriya of Kumbhakarna (about
a.d. 1438), Bhandarkar, Report, 1887—1891, p. lviii, and
commented on by Soma, a.d. 1273,see MS.Sansk.d.T32
( 1154 ). Cf. also Bendall, Brit. Mus. catal., p. 178.
The text is bounded on either side by two red lines.
Measurement, Sfc.: this is part 3 of the MS. described
under 160 .
463 — MS. Walker 205 1
Vrttaratnakara, A.D. 1741 .
Contents: the text is bounded on either side by two
red lines. ______
Measurement, fyc.: this is part 6 of the MS. described
under 238 .
Date: f. 13i v : sam 1798 varse sake 1663 ( = a. d.
1741 ) pravarttamane posavada 2 some l
Scribe: f. I3i v : likhitam bhataprabhujikena ciram-
jlvibhaijivana (?) tathacalabhajlmoraraji tathabhavdni -
pathandrtham |
464 — MS. Wilson 225 b
Vrttaratnakara, A.D. 1833 .
Measurement of binding: 1 iy X 8j in.
Material: European paper water-marked ( W.
Balston & Co./ and ‘ J. Whatman & Co/
No. of leaves : iii + 93 4 - iii blank. Originally foliated
in four parts, containing 19 +6 +(45 + i) + (io+ 12)
leaves. The MS. is arranged like a European book.
Date: all the parts were written at one time;
f. 93: amkastavasubhuvarse bhadre masl site dale \
pratipadravivare ca Madhavaramena likhyate 11
465 — MS. Walker 179 ^
Bhavarthadlpika, A.D. 1770 .
Contents: printed at Bombay in 1864. The scribe
has added nine lines at the end as to errors, &c.
The text is bounded on either side by two bright
red lines.
Measurement, Sfc.: this is part 4 of the MS. described
under 170 .
466 — MS. Wilson 225 “
Vrttaratnakarasetu, A.D. 1833 .
Contents: for the epilogue see Mitra, Notices, II,
127. Cf. also Weber, Catal., I, 225; Eggeling, India
58
CATALOGUE OF
Office catal.. p. 303 ; Bhandarkar, Report, 1887-1891,
pp. lxii, lxxx, who writes Apajibhatta.
Measurement, Sfc.: this is part 1 of the MS. described
under 464.
467 —MS. Wilson 225 c
Commentary on Vrttaratnakara, A. D. 1833.
Contents: Narayana’s date is given on f. 70: ydti
vikramasake dvikhasadbhu 1602 sammite sitagakdrtike
rude l This is a. d. 1546, not a. d. 1680; the correction
is given in Aufrecht, Catalogus Catalogorum, p. 597, and
Eggeling, India Office catal., p. 303, who also gives
his great-great-grandfather’s name as Nagapasa. The
reading in this MS. is Naganagadha. Cf. Winternitz,
R.A.S. catal., pp. 70, 228.
Measurement, Sfc.: this is part 3 of the MS. described
under 464.
468— MS. Wilson 349 c
Chandomanjari, 18th cent.?
Contents : edited, with notes by Taranatha Tarka-
vacaspati, Calcutta, 1870. Cf. Eggeling, India Office
catal., p. 305. It is of respectable antiquity, being
quoted by Laksminatha in his Pingalapradlpa (Bhan¬
darkar, Report, 1887-1891, p. Ixxiii), which was com¬
posed in a. d. 1601, Kielhorn, Report, 1880,1881, p. 71.
Measurement of binding : I5f X 5 in.
Material: ff. 1—82 are of yellow country paper.
No. of leaves : ii + 110 + ii blank. The three parts
in the original foliation have 33+ (44+ 5)+ 28 leaves.
469— MS. Wilson 225 <1
Chandomanjari, A. D. 1833.
Contents : lacunae are extremely frequent.
Measurement, Sfc.: this is part 4 of the MS. described
under 464.
470— MS. Walker 192c
S'rutabodha, A. D. 1692.
Contents: the text is bounded on either side by
two red lines. The work must be fairly old to have
so many commentators. Cf. Aufrecht, Leipzig catal.,
pp. 266, 267. _____
Measurement, 8fc.: this is part 3 of the MS. described
under 702.
Date: f. 86: samvata 1748 (*a. d. 1692) caitra-
suklanavamydm l
SANSKRIT MSS.
471 —MS. Mill 49
Samgltaratnakara, A. D. 1825.
Contents: see Eggeling, India Office ca/a/.,pp.3i6sq.;
Mitra, Bikaner catal., pp. 522-525. Edited by M. R.
Telang, Poona, 1897.
The author’s father Sodhala was srikaranadhipa
under Bhillama and Jaitrapala, Yadavas of Devagiri,
and his patron, Singhana, reigned a. d. 1210-1247,
see references in Duff, Chronol. of India, p. 177.
The text is bounded on either side by four or five red
lines, from f. 51 to the end by three or four only. There
are many lacunae and a few diagrams. On f. 1 is
a rough headpiece. _____
Measurement of binding : 13 x 4j in.
No. of leaves : i + 67 + i blank. The three pairts in
the original foliation have 29 + 21 + 17 leaves.
Bate :
(1) f. 1 : Samgitaratndkarapustakann sarmnat 1881
(= a. d. 1825) agahana \
(2) f. 29: sammat 1881 agahana l
(3) f. 67 v : sammat 1881 kdrtikakrsnapaksa 5 sa-
mapto ’yarn grathah 1
472— MS. MiH 47c
Samgltaratnakara, Prabandliadliyaya,
after A. D. 1830.
Contents: part of the same MS. as 477, and in the
same style.
Measurement, 8fc.: this is part 3 of the MS. described
under 480.
473— MS. Mill 48^
Samgltaratnakara, Taladhyaya, after A. D. 1830.
Contents : the MS. consists mainly of diagrams with
illustrative text. Much is wanting at the beginning.
The text is bounded on either side by two red lines.
In Eggeling, India Office catal., p. 316, this is the
fifth chapter; ibid., p. 318, the sixth.
Measurement, fyc.: this is part 3 of the MS. described
under 478.
474— MS. Wilson 340 a
Samgltaratnakara, Nrttadhyaya, about A. D. 1820.
Measurement of binding : 11| x 9-| in.
Material: paper water-marked ‘Budgen & Wilmott.’
No. of leaves : i + 74 + i blank. Originally foliated in
two parts, with 47 (+ 1 blank) + 26 leaves. Arranged
like a European book.
Date: the latest date in the water-mark is 1808.
Scribe: f. 47 : likhitam Laksminathabhatta Mathurd-
sthita Tailimgabrdhmana Pamcadravaladesasta subham 1
APPENDIX TO VOL. I (466-482)
59
475 —MS. Ouseley 65 b
Ragavibodha, 18th cent. ?
Contents: identical with the anonymous work in
Mitra, Bikaner catal., p. 518. A copy of this MS.
*vas used by Sir William Jones—who rated the work
i'ery highly—for his Discourse on the Musical Modes,
Asiat. Researches, III. It cannot be old, however, as
Sarngadeva lived about a. d. 1260. Edited, with
commentary, by P. G. Gharpure (parts i-v), Poona,
1895, and by R. Simon, Leipzig, 1904.
Former owner: this MS., part of a volume with
Arabic, Persian, and Hindi tracts, and an essay on music
by Alstedius with interlineary Persian trans., belonged
to Col. Polier, and this part, with the treatise on music,
was eventually purchased in London by Ouseley.
Measurement of binding : 9^- x in.
Material: Indian paper, polished.
No. of leaves: ii + 64 (music)+19 (re-numbered as
37 pages)+ ii blank.
476— MS. MiU 48 b
Samgltadarpana, &c., 19th cent.?
Contents: on the yarious forms of this work see
Simon, Z.D.M.G., LVI, 129 sq. He cites Kallinatha,
who lived under the son of Devaraja II of Yijayanagara
(1422-1447), Simon, J.R.A.S., 1902, pp. 661-663.
See Eggeling, India Office catal. , p. 319; Mitra, Notices,
VII, 259, 260, Bikaner catal., pp. 519, 520.
Book I, 162 verses, ends on f. 20; Book II, verses
1-94, ends on f. 29.
The text is bounded on either side by two red lines.
There are a few lacunae marked.
Measurement, fyc.: this is part 2 of the MS. described
under 478 .
477— MS. Mill 47 b
Samgltadarpana, Prakirnakadhyaya, 10th cent. ?
Contents: the text is bounded on either side by two
red lines. Evidently this MS. forms part of the work
of the scribe of 478 , 476 , 473 .
Measurement, fyc.: this is part 2 of the MS. described
under 480 .
478— MS. MiU 48“
Samgltadarpana, Prabandhadhyaya, after A. D. 1830.
Contents: the book contains 188 slokas.
The text is bounded on either side by two red lines,
and the sub-titles are in red ink. There is a lacuna
on f. 9. ^ — _
Measurement of binding : 12 j X 3^ in.
No. of leaves: i + 43 (really 44 leaves, f. 31 being
repeated) + i blank. The three parts in the original
foliation have 10 +19 +14 leaves.
Date: the latest date in the water-mark is 1830.
479— MS. MiU 47 d
Samgltadarpana, Vadyadhyaya, Taladhyaya,
Nrtyadhyaya, 19th cent.?
Contents : part of same MS. as 478 .
Measurement, fyc.: these are parts 4 and 5 of the MS.
described under 480 .
480— MS. Mill 47“
Samgitanarayana, 19th cent.?
Contents: see Mitra, Notices, VIII, 40 (different
from ibid., I, 180).
Measurement of binding : I2jX 3^ in.
No. of leaves : i + 207 + i blank. The five sections in
the original foliation have 121+4 + 22 + 6 + 54 leaves.
Date : about a. d. 1813-1820.
Scribe : f. I2i v : li° srivanwamdopadhydyena Easy am
Ramesvarasanne vai° su° sa-kiye \
481— MS. Wilson 303 b
Ragamala, after A. D. 1810.
Contents: the reading sathalendra on f. 47 y is
certain. The date is given in this verse on f. 47^:
tadbhuyasya purohitena sudhiya sriksemakarnena vai
vesottamsamahesapathakasutenaisa navltadhuna 1 sake
vahunavavdhicamdrasahite pakse samasikrta sukle sra-
vamasipaksatikuje sriragamala subha M 14 II yavat tisthati
Ramaravanakathu &c. tavad iyam hi tisthatutaram
sriksemakarnodita 11 iti srimahesapdthakatmasrlksema-
karnapathakajddhayatisukharthaviracita Ragamala sa-
maptah \ The date must be sake 1492 (=a.d. 1570 ).
The other alternative, 1792 , is impossible. Cf. Mitra,
Bikaner catal., p. 516 ; Eggeling, India Office catal.,
p. 320 (who reads Jatava).
Measurement, fyc.: this is part 2 of the MS. described
under 330 .
482— MS. Wilson 301 b
Ragamala, A. D. 1820.
Measurement, fyc.: this is part 2 of the MS. described
under 515 .
60
CATALOGUE OF SANSKRIT MSS.
483— MS. Wilson 234b
Hastaratnavali, 19th cent.?
Measurement, §c.: this is part 2 of the MS. described
under 272.
484— MS. Wilson 335
Dasarupaka, 19th cent. ?
Contents: edited by F. Hall, Calcutta, Bibl. Ind.,
1865; K. P. Parab, Bombay, 1897.
Dhanamjaya and his brother Dhanika flourished
under Munja, about a. d. 980, Duff, Chronol. of India,
p. 100 (reff). The two parts are in different hands.
The text occupies the centre, the commentary the top
and bottom, of each page.
Measurement of binding : 14-j X 8-7 in.
No. of leaves : ii + 28 +ii blank. The original foliation
makes 19 + 9 leaves.
Bate : about 1820 probably.
Scribe: cf. 725, 737.
485— MS. Wilson 336
Kavyadarsa, A. D. 1647.
Contents : Dandin’s date is still doubtful, but it seems
best to accept the view of Weber, Ind. Streif'., I, 312 sq.,
and to put him on stylistic grounds before Subandhu
and Bana. To this may be added the points of priority
to Vamana (probably end of 8th cent. a. d.) enumerated
by Pischel, Eudrata, p. 21, and in the Bodl. catal.,
p. 207b. Pischel’s own attempt to date him by proving
his authorship of the Mrcchakatika is refuted by
Bohtlingk, in the preface of his edition, Leipzig, T890,
and by Peterson, Basakumaracarita, pp. 1-9, who
prefers to put Dandin in the 1 ith cent., insisting that
he quotes Bana and Vamana, and knows so late a work
as the Mrcchakatika, but this is impossible. See also
Jacobi, Ind. Stud., XVII, 244 ; Mahesacandra Nyiiya-
ratna, Proceedings of Asiat. Soc. Bengal, 1887. He is
later than Kalidasa, J.E.A.S., 1905, p. 841.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement of binding : 1 ij x 6| in.
No. of leaves: ii + 65 + ii blank.
Bate: f. 65: samvat 1703 ( = a. d. 1647) samaye
dsvinavadivaturddasyam \
486 — MS. Wilson 333 a
Kavyadarsa, A. D. 1815.
Contents : certainly transcribed from a Bengali MS.
Measurement of binding: 11^X9^ in.
Material: paper water-marked £ W. Balston & Co.
1815/ or ‘ J. Whatman.’
No. of leaves : i 4- 59 + i blank. The two parts in
the original foliation have 24 + 35 leaves. Arranged
like a European book.
Bate : the latest date in the water-mark seems to be
i8i 5-
Scribe: f. 24 v : likhitam sripitdmbarasarmania I svu-
ksaram ca I
487— MS. Wilson 333b
Kavyalamkaravrtti, after A. D. 1815.
Contents: Vamana’s date is probably the end of
the 8th cent. a. d. He quotes Subandhu and Bana
(620 a. d.), and is quoted by Abhinavagupta (1000 a. d.),
and according to this author he was known to Ananda-
vardhana (about a. d. 870, see Jacobi, Vienna Or.
Journ., IV, 236 sq.). There is no good reason for
rejecting Biihler’s view, Kusmir Report, p. 65, that he
was Jayiipida’s minister (a. d. 779-813). Cf. Pischel,
Eudrata, pp. 22 sq.; Keith, J.E.A.S., 1901, p. 581.
Cappeller, Vdmana^s Stilregeln , p. iii, objects that he
quotes Kaviraja, but either this Kaviraja (who is doubt¬
less the same as the person mentioned by Rajasekhara)
is not the author of the Riighavapandavlya, or pro¬
bably that poem has been falsely dated, and the verse
(see 212) refers to some earlier Munja, possibly an
ancestor of the Paramara line. Cf. on 212.
Edited by A. Borooah, Calcutta, 1883; Cappeller,
Jena, 1875; and in Kdvyamdla, XV.
Measurement, §c.: this is part 2 of the MS. described
under 486.
Sci'ibe : as in 486.
488— MS. Wilson 345
Vamanavrttitika, after A.D. 1810.
Measurement of binding : 13 X 9^ in.
Material: paper water-marked ‘ S. & C. Wise.’
No. of leaves : iii + 48 + iii blank.
Bate: f. 48 : sauravaisdkhasya saptamadivase soma-
vare 1 The latest date in the water-mark is 1810.
Scribe : f. 48 : likhitam srlpltamvarasarmand 1
489— MS. Wilson 246
Sarasvatikanthabharana, A.D. 1821.
Contents: edited by Anundoram Borooah, London,
1883. For Bhoja see references in Duff, Chronol. of
India, p. 109.
Clearly two scribes have been employed; to the
second belong ff. 20-34, 54-72. The whole has been
APPENDIX TO VOL. I (483-495)
61
i good deal corrected by a later hand, with yellow
igment. —
Measurement of binding : 14J X 6|- in.
No. of leaves: ii+151+ii blank. Originally each
hap ter was foliated separately, having 19 + 34 + 19 +
5 + 44 leaves.
Bate: this is given specifically only for the first
iand, but it undoubtedly applies to both. F. 53:
amvat 1877 ( = a. d. 1821) vaisdkhasuklanavamydm
ihrguvasare. F. 15i v : srisamvat 1877 mdsdnam md-
otame mdse vaisakhamase suklapakse pamcamyam
mmdravasare l
Scribe: the name of the first scribe is on f. 53:
ikhitam vrahmanamadhorama l
490 —MS. Wilson 164
Ratnadarpana, A. D. 1822.
Contents: Aufrecht, Catalogus Catalogorum, p. 699b,
says, ‘most likely written by request of Ramasimha-
deva.’ The very close correspondence between this
MS. and the short extracts in Mitra, Notices , IX, 231,
especially the last verse, shows that this is a copy
of his MS. (dated samvat 1874), or that both are from
the same original. Cf. Peterson, Report , 1884-1886,
p. 349 ; Eggeling, India Office catal., p. 322. The MS.
has been somewhat corrected by a later hand.
Measurement of binding : 14J x 6J in.
No. of leaves: ii + 106 + ii blank.
Bate : f. 106 : srisavat 1876 mitlb. jethavadi 15 \
491 —MS. Wilson 243 a
S'rngaratilaka, A. D. 1821.
Contents : edited critically by R. Pischel, 1886. The
identification, proposed by Pischel, of the author of
the Kavyalamkara (who is son of Vamuka, and bears
the surname Satananda), with this Rudra, has been
disproved by Jacobi, Vienna Orient. Joum., II, 151 sq.,
who replies to Pischel’s objections (Z.B.M.G., XLII,
296), ibid., 425 sq. The author’s date thus becomes
quite doubtful: probably 10th cent. a. d., as quoted by
Hemacandra.
The MS. has been sporadically corrected by a later
hand. It is E in Pischel’s edition, p. 30, and is ‘ very
incorrect, and apparently copied from an original in
other than Devanagari characters.’
Measurement of binding: 13^ X 6j in.
No. of leaves : iii + 75 + ii blank. The three parts
in the original foliation have 17 + 43 + 15 leaves.
Bate: samvat 1877 ( = a.d. 1821) asadhasukla 3
guruvasare \
492— MS. Wilson 332 c
Beginning of Alamkarakaustubha, 18th cent. ?
Contents: this contains only I, 1—14, and a portion
of verse 15. The commentary is identical with that
attributed to Lokanatha Cakravartin by Mitra, Notices ,
IV, 239. It is probable—though not certain—that
493 contains the same commentary ; at least they
proceed on exactly the same lines.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement, fyc.: this is part 3 of the MS. described
under 505 .
493— MS. Wilson 61
Alamkarakaustubha, 19th cent. ?
Contents: see Mitra, Notices, IV, 237; Eggeling, India
Office catal., p. 345. The author of this tlka cannot
be determined because the beginning is lost, and Mitra,
l. c., 239, only quotes the beginning of Lokanatha,
while Eggeling quotes none of Vrndavana. This MS.
ends: tata evdvasitam tabhih sviyatvena niscitam yat
sydmdmrtam pivamah 1 samdpteyam Alamkarakaustubha-
sya tlka \ srimadgovimdapdthapadmam vamde srlmanma-
danamohanapadapadmam vamde subham astu \
Measurement of binding: 13 -g- X 7^ in.
No. of leaves: ii + 184 + ii blank. The original foliation
makes 196, but ff. 1-13 are lost, and an odd leaf is
bound in as f. 1.
494— MS. Wilson 411
Alamkarakaustubha, after A. D. 1814.
Contents: the leaves are numbered from 16 onwards.
Measurement of binding : I 2 j X 10 in.
No. of leaves : iii +183 + iii blank. Arranged like
a European book.
Bate: the paper is water-marked 1814.
495 — MS. Wilson 406
Alamkarasarvasva with AlamkaravimarsinI,
19th cent. P
Contents: in Mitra, Notices, IX, 117, the author’s
name appears as Rajanakarucaka. He really is Ruyyaka,
teacher of Mankha, a. d. 1140; see Biihler, Report,
PP* 5 L 68. Mankhuka (? = Mankha) is given as the
author in Burnell, Tanjore catal., p. 54; Winternitz,
R.A.S. catal., p.208. Jagadratha lived about a. d. 1200.
The text is fairly accurate. It is bounded on either
side by three or four red lines. Text and commentary,
edited by Durgaprasada and Paraba, Kavyamala, XXXV.
Measurement of binding: 12§ x in.
CATALOGUE OF SANSKRIT MSS.
(52
No. of leaves: ii+ 147 + ii blank. In the original
foliation there are 44 (really 43, there being no f. 11) +
104 leaves.
496— MS. Wilson 227
Alamkarasarvasva with Alamkaravimarsini,
after A.D. 1810.
Measurement of binding : 13} x 9y in.
Material: European paper water-marked c S. &
C. Wise.’
No. of leaves: iii + 97 + iv blank. Arranged as a
European book. The parts have 30 + 67 leaves.
Date : the paper is dated 1810, except f. iii, which is
dated 1806.
497— MS. Walker 161*
Kavyakalpalatavrttiparimala, fragment, 17th cent. ?
Contents: see Eggeling, India Office cat at., pp. 339-
341 ; Mitra, Notices, VII, 282. Bhandarkar, Deport,
1883, 1884, p. 6, gives the author as Arisimha (writer,
about a. d. 1240, under Vlsaladeva of Anhilvad, of the
Sukrtasamkirtana), whose work Amaracandra completed;
cf. Peterson, Deport, 1886-1892, p. viii.
The text is bounded on either side by two double
red lines. In the centre of each page is the usual
Jaina figure. Many lacunae are marked.
Measurement of binding : 1 X 6 ^ in.
No. of leaves: ii + 160 + ii blank. The original foliation
makes 79 (really 61, as If. 36-53 are lost) + 20+i2 +
41 + 22 leaves.
Character: Jaina Devanagarl.
498— MS. Wilson 173 a
Kavikalpalata, after A. D. 1810.
Contents: see Eggeling, India Office catal., p. 339;
Weber, Catal., I, 228 ; Burnell, Tanjore catal., p. 54.
It is quoted by Halayudha (a. d. 1474) and llayamukuta
(a. d. 1431), and therefore cannot be later than the
14th cent., Aufrecht, Z.D.M.G., XXVIII, iii, no. 28.
Printed in PratnakamranandinI, nos. 1— 31. His
father’s name is to be read Vagbhata.
Measurement of binding : i6-| X 4^ in.
Material: yellow country paper.
No. of leaves: ii + 69 + ii blank. The two parts in
the original foliation have 56 (really 54, there being
no ff. 37, 38)+ 15 leaves.
499— MS. Wilson 340 b
Kavyacandrika, after A.D. 1810.
Contents : see Eggeling, India Office catal., p. 344.
The author’s father, Kavikarnapura, was born in
a.d. 1524, Aufrecht, Catalogus Calalogorum, p. 86.
For NyayavagTsa’s work see Mitra, Notices, II, 71,
whose MS. is also incomplete.
Measurement, 8fc. : this is part 2 of the MS. described
under 468.
Scribe : both parts are by the same hand.
500— MS. Wilson 512*
Kavyaprakasa, A. D. 1770.
Contents : the work was really composed by Mammata
and Allata, as is proved by Stein, Kasniir catal.,
pp. xxiii—xxvi, see on MS. Sansk. e. 61 (1158).
The text is occasionally bounded on either side by
four red lines. ______
Measurement of binding : gf x 5^ in.
No. of leaves: ii + 89 + ii blank. The two parts in
the original foliation have 75+16 (really 14, ff. 2, 3
being lost) leaves.
Date: f. 75: abde tarkkamujebhacandraganite 1826
(= a. d. 1770) maghe site paksake paheamyd l
501— MS. Wilson 332'»
Kavyaprakasiyakarikavali, A.D. 1770.
Contents: the scribe, Kaladhara, was no doubt the
author. _____
Measurement, fyc.: this is part 2 of the MS. described
under 505.
Date: note the reverse order of the date. It
continues: C ca mdsy dsvine krsne sambhutithdv rtau ca
saradine kirn ca kanydm gate 1 naksatre pilrdevate
samalikhat some ca vdre vasan Gamgadharapure Kala¬
dhara imam vidvdnmude kdrikd 11111
502— MS. Walker 222^
Kavyapradipa, A.D. 1673 and 18th cent.?
Contents : see Eggeling, India Office catal., p. 328;
Mitra, Notices, IX, 124; Peterson, Deport, 1882, 1883,
p. 26, Deport, 1883,1884, p. 17.
In the older parts of the MS. the text is bounded
on either side by two double red lines. In the new
parts, ff. 41, 44, 47, 48 are on yellow paper.
Measurement, Sfc.: this is part 2 of the MS. described
under 337 .
Date: f. 168: srinrpasdlivahanasake 1595 ( = a. d.
1673) pramadisamvatsare murgasirsakrsnanavamydm 1
Scribe: f. 168: Sathopandmakatrivikramabha/tena
likhitam idam subham \
APPENDIX TO VOL. I (495-509)
f»3
503— MS - Wilson 7
Kavyapradipa, &c., 18th cent. ?
Contents: the MS. is well but rather inaccurately
written on yellow country paper.
Measurement of binding : 14^ X 7 j in.
No. of leaves: ii + 102 + ii blank.
504— MS - Wilson 220
Kavyapradipatika, after A.D. 1805.
Contents: the commentary is not that of Nagesa,
is far as can be judged from the specimen in Mitra,
Notices, X, 236, 237. It may be that of Vaidyanatha,
son of Ramacandra. ___
Measurement of binding : n-| x 9^ in.
No. of leaves: iii + 75 + iii blank. Arranged like
a European book.
Bate: the paper is of European manufacture,
water-marked c T. Budgen ’ and ‘ J. Whatman/ and
bears the dates 1804 and 1805, but there is no proof
that the MS. was written after 1815.
505— MS. Wilson 332 a
Kuvalayananda, A.D. 1706.
Contents: Venkataraya of Vijayanagara flourished
about a. d. 1535, Duff, Chronol. of India, p. 309.
On the Candraloka, which is by Jayadeva, see Eggel-
ing, India Office catal., pp. 383 sq.; Aufrecht, Leipzig
catal., pp. 268, 269. The name may best be spelled
perhaps Appayyadlksita. He is dated in the second
half of the 16 th cent., see the preface to the Vizianagram
Sanskrit Series edition of the Siddhantalesasamgraha.
Measurement of binding : 13L x 6| in.
No. of leaves : ii + 126 + ii blank. The three parts
in the original foliation have (] + )ib9 + 6 +10 leaves.
Bate: f. no: marge mdsy asite pakse pamcamydm
camdravasare \ And below : srisam 1852 ( = a. d. 1796) 1
Scribe: f. no: Jwdi'dmena likhitam srivisvesapra-
sadatah mil
506— MS. Wilson 340 b
Rasataranginl, after A.D. 1810.
Contents : see Eggeling, India Office catal., p. 353 ;
Mitra, Notices, III, 311; Burnell, Tanjore catal., p. 57,
who calls him a Maithila. The correct reading in the
Kasamanjari is Videhabhuh, see Bhandarkar, Report,
1882, 1883, pp. 12, 13; Bendall, Journey in Nepal,
p. 61. Aufrecht, Leipzig catal., p. 271, gives his
father’s name as Gananatha.
Measurement, fyc.: this is part 2 of the MS. described
under 474 .
Material: paper water-marked ‘ G. Jones/
Bate : the latest date in the water-mark is 1809.
507 —MS. Wilson 493 a
Rasamafijari, 19 th cent. P
Contents: cf. Eggeling, India Office catal., p. 355,
and on MS. Sansk. d. 130 ( 1160 ). Gopala wrote a com¬
mentary on this work in a.d. 1428, Stein, Kasmlr
catal., p. xxx.
Many scholia are written in the margin.
Measurement of binding : io|- x 5^- in.
No. of leaves: ii-f 179 +ii blank. The seven parts
in the original foliation have 20 (really 16, ff. 7—10
being lost)4-51 (really 52, as f. 26 is double) + 3 + 6+
21 + 10 + 71 leaves.
Scribe : ff. 1—4 are written in Devanagarl with some
traces of Kasmir characteristics.
508— MS. Wilson 493 b
Rasamanjariprakasa, A.D. 1819.
Contents: see Eggeling, India Office catal., p. 355 b
(MS. written 1713 a. d.); Mitra, Notices, V, 266. The
commentary in Aufrecht, Leipzig catal., p. 272, is
different, and does not seem to be derived from this.
After f. 50 of the original foliation a leaf is inserted
containing part of the commentary on verse 16. F. 26
is repeated.
Measurement, 8fc.: this is part 2 of the MS. described
under 507 .
Material: yellow paper, except f. 67.
Bate : f. 67 v : samvat 1895 sake 1739 (=a. d. 1817)
ya pustakam samdptah vdraniamgalakeh, l
509— MS. Walker 205^
Vagbhatalamkara, 17th cent.?
Contents: the date of the author is determined by
IV, 132, in addition to the passages in Aufrecht, a&
falling within the reign of Jayasimha, Caulukya prince,
of Anhilvad, a. d. 1093-1143, Bhandarkar, Report, 1883,
1884, pp. 155, 156. Cf. for the work, Eggeling, India
Office catal., p.330; Weber, Catal, II, 275 sq.; Burnell,
Tanjore catal., p. 57. Bendall, Journey in Nepal, p. 61,
gives him the title mantrin (of Jayasimha); Zachariae,
Gott. Gel. Anz., 1884, pp. 300 sq., distinguishes this
author from the writer of the Alamkaratilaka.
Edited by Anundorum Borooah, London, 1883, and
in Kdvyamald, XLVIII.
The text is bounded on either side by two double
red lines. In the centre of each page is the usual
Jaina mark. ___
Measurement , Sfc. : this is part 8 of the MS. described
under 238 .
Character: Jaina Devanagarl.
64
CATALOGUE OF SANSKRIT MSS.
510— MS. Wilson 0
Sahityadarpana, 19th cent. ?
Contents: the work was composed in the 15th cent,
on the banks of the Brahmaputra, Eggeling, India
Office catal., p. 337 ; the translation of Ballantyne was
finished by Bfibu Pramadadasa Mitra, 1875. Cf. also
.1 aganmohanasarman, Candakaustka, preface, p. 2. Edited
with Ramacarana’s commentary, Nirnaya Sdgara press,
1902.
The MS. is fairly accurately written on yellow
country paper. —
Measurement of binding : 17^- X 6 ;^ in.
No. of leaves : ii + 97 + ii blank.
511 —MS. Wilson 5
Commentary on Sahityadarpana, after A. D. 1810.
Contents: the commentary was composed a.d. 1700,
the author being a brahmana of the Kadha country,
in Western Bengal, Eggeling, India Office catal.,
p. 337 ; Mitra, Notices, VII, 255.
The MS. is carefully written on yellow country
paper. - ■
Measurement of binding : 17 J.- x 5^ in.
No. of leaves : ii + 212 + ii blank.
512— MS. Wilson 48
Commentary on Sahityadarpana, Books I-III,
19th cent.?
Measurement of binding : 19^X4! in.
Material: yellow country paper.
No. of leaves : ii + 41 + ii blank.
513— MS. Wilson 173 b
Commentary on Sahityadarpana, Book VI,
after A.D. 1810.
Measurement, 8fc.: this is part 2 of the MS. described
under 498.
Scribe : different from that of 498.
514 —MS. Wilson 303‘1
Vidagdhamukhamandana, after A.D. 1810.
Contents: cf. MS. Sansk. d. 83 (1163). See also
Weber, Catal., II, 285, 286 ; Mitra, Notices, IV, 294,
Bikaner catal., p. 288 ; Burnell, Tanjore catal., p. 164 b.
Quoted in S'firngadhara’s Paddhati (a.d. 1363), Aufrecht,
Z.B.M.G., XXVII, 41. Apparently also by Jahlana
(a.d. 1260) in the Subhasitamuktavali, Bhandarkar,
Report, 1887—1891, p. xxx, and by Rayamukuta
(a.d. 1431), Bhandarkar, Ixeport, 1883, 1884 , PP* 62,
467 ; Keith, Ind. Inst, catal., p. 5.
Measurement, Sfc. : this is part 4 of the MS. described
under 830.
515— MS. Wilson 301 a
Vidagdhamukhamandana, after A. D. 1810.
Measurement of binding : 13 j x 9^ in.
Material: paper water-marked ‘ S. & C. Wise/
No. of leaves : iii + 33 + iv blank. The three parts
in the original foliation have 9 (+ 1 blank)+ 6 +17
leaves. Arranged like a European book.
Bate: the latest date in the water-mark is 1810,
but the MS. must have been written after 514 .
Scribe : by the same hand as 482.
516— MS. Wilson 39c
Vidagdhamukhamandana, after A. D. 1810.
Measurement, fyc.: this is part 3 of the MS. described
under 338 .
Scribe : 212,187, 510 seem to have been written by
the same hand.
517— MS. Wilson 237 a
Kamasutra, A.D. 1821.
Contents : see on MSS. Sansk. c. 11,12 (1608,1009).
Translated by Lamairesse, Paris, 1891; Schmidt, Berlin,
1897. The date of the composition of this commentary
is given on f. 190: sardvdhikari&itamsusvamite 3 vde
3 dhikasy ayatn \ gramtho Yisvesakrpaya krtah krtimude
sada II This is probably samvat 1845 ( = a. d. 1789).
Lacunae are frequent.
Peterson, Journal Bombay Br. JR. A. S., XVIII, no,
points out that Bhavabhuti refers to the Kamasutra,
and says that Kalidasa does so also. Cf. It. Schmidt,
Beitrage z. indischen Erotik, Leipzig, 1902, I, 3 sq.
Measurement of binding : 14x6^ in.
No. of leaves: ii + 227 + ii blank. The original foliation
has 189 + 36 leaves, ff. 1, 191 being inserted.
Bate : f. 190 : samvat 1877 ( = a. d. 1821) bhddrapa-
bhade mdse \ krsne pakse astamydm saumuvdsare 1
Scribe: f. 190: Rdmandrdyanabrdhmana likhyate l
Kdsyam madhye l rajamadira \ Rdma 1
518— MS. Walker 189
Anahgarahga, A.D. 1780.
Contents: see on MS. Sansk. c. 44 ( 1610 ), but for
the date (not later than 13th cent.) see R. Schmidt, l.c.,
pp. 23 sq. Ff. i~79 v contain text only, ff. 80-97
pictures with a verse describing the scene above each.
The lower half of each has been cut away, probably
before passing into Walker’s hands. Ganesa, on f. 1 i v ,
is left untouched.
APPENDIX TO VOL. I (510-523)
65
The text is bounded on either side by two or three
ed lines.
Bound in a native binding with flap.
Measurement of binding : 7 ^ X 8 in.
No. of leaves : ii + 97 + i blank. Arranged like a
European book.
519— MS. Wilson 464
Anangaranga, 10 th cent.?
Contents: the ten chapters end on If. 4 V , 8, I 2 V , 18,
20 v , 31, 38, 43 v , 48 v , 56 v . Chapters 1-6 and 10 have
16, 18, 26, 41, 19, 100, 40 verses, the number in the
ather cases not being given. A few corrections have
been made by a later hand.
Measurement of binding: 8^- X 5^ in.
No. of leaves : ii + 56 4 - i blank.
520— MS. Wilson 325
MImamsatantravarttika, A. D. 1525.
Contents : B is the Tantravarttika II, i, as in 522.
The text is bounded on either side by two red lines.
A is the S'lokavarttika mixed up in terrible confusion
with the Tantravarttika. F. 82 contains 45 verses of the
beginning of the Slokavarttika, and it is continued on
ff. 42, 43, 37, and on scattered leaves, and on ff. 83-96.
Probably the whole was originally a MS. of padas 2-4
of adhyaya I of the Tantravarttika; colophon of 2 on
f. 53 v , colophon of 3 on f. 8i v , colophon of 4 on
f. 11 i v . Prefixed to this was the versified commentary
on pada 1, which has been confused with it. Its colo¬
phon is on f. 44 v , but only a small portion remains.
On the S'lokavarttika see Eggeling, India Office
catal., p. 683; Hall, Bibliog. Index, p. 171 ; Mitra,
Notices, VII, 73 sq. Printed, Bandit, N. S., Ill and
IV, and with commentary, Benares, 1898. Both
works are direct commentaries not on Jaimini’s Sutras
but on Sahara's Bhasya.
The text is bounded on either side by two double
red lines.
Former owner:
(1) B belonged, according to f. 1, to Rame^vara-
bhatta.
(2) A belonged, see f. I4 V , to Jayabhattagosvamin.
Measurement of binding: 12^ x 4-^ in.
A 0. of leaves: ii + 111 4- ii blank. The first part has
25 leaves, the numbering of the rest is mostly lost.
Bate :
(1) For B see 523 , ff. 1-59, beginning of 16th cent.
(2) For A see 523 , ff. 60-112, about a. d. 1525,
by Visnusarman.
BODL. SANS. CATAL. APP.
521— MS. Wilson 277 a
MImamsatantravarttika, fragment, 16th cent.?
Contents: the text is bounded on either side by
three black lines. __
Measurement of binding: 13J X 4% in.
No. of leaves : i+ 118 + i blank. In the original
foliation the two parts have 37 and 78 leaves, but
several leaves in part 2 are split.
Character: Jaina Devanagari.
522— MS. Wilson 273 b
MImamsatantravarttika, A.D. 1542.
Contents: this is Tantravarttika II, t, cf. Eggeling,
India Office catal., p. 685, and on 525 .
The text is bounded on either side by two double
red lines. .
Former owner: on f. 72 v appears: bhatfanilakamthi-
yam l
Measurement, 8fc.: this is part 2 of the MS. described
under 525 .
Bate: f. i29 v : savat 1598 ( = a.d. 1542) samae
sravanavadi pratipada I
Further on this date is given : samvat 1686 ( = a. d.
1630) asvinasuddhatrtiyaydm l This is not in the same
hand as any of the other notices.
Scribe: f. 129 v : lisite Gamgddasa kdesthd 1 and
infra : Naraharind sodhitam svapathanakdlc 1 He has
made a fair number of erasures and corrections.
523— MS. Wilson 275
Nyayasudha, A.D. 1525.
Contents : see Hall, Bibliog. Index, p. 170; Eggeling,
India Office catal., p. 689; Burnell, Tanjore catal., p. 81 b .
Printed at Kumballonam, n. d.
Ff. 1-59 are written by one hand, the rest by
another. The text is bounded on either side by two
red lines. The writing of the second hand is painfully
minute.
Former owner: f. 1 : Ramesvarabhatta for ff. 1-59.
Measurement of binding : 12^ X 4^ in.
No. of leaves : ii 4- 112 + ii blank. The original
foliation is mostly lost. Part 1 had 61 ff., but ff. 9,
10 are lost.
Bate: f. 93 v : munikrtakrtabhutihsammite sakdle
saradi subhatare 9 ,smin pdrthive yamyagofe 1 nabhasi
sitatrtlye sunyasunau dine sedy alikhad akhilam etat
pustakam Visnusarma w
On f. ii2 v appears: Jayabhatta (?) gosvaminah (?) 1
Cf. 520 , ff. 1-25, for ff. 1-59, and the rest for
ff. 60 to the end.
K
CATALOGUE OF SANSKRIT MSS.
(id
524—MS. Mill 46 b
MimamsanyayaprakaSa,
flF. 107-146, 16th cent., the rest by a later hand.
Contents: see Burnell, Tanjorecatal., p.85; Eggeling,
India Office catal., p. 711; Mitra, Notices, I, 167;
Aufrecht, Leipzig catal., p. 275.
The text is bounded on either side by a red line.
There are a few corrections with yellow pigment by
a later hand.
Measurement, fyc.: see on MS. Mill 46.
525— MS. Wilson 273 a
Mimamsabhasyavivarana, 17th cent. P
Contents : Kumarasvamin is of course Kumarila,
cf. Mitra, Notices, V, 204 (verse 2); Aufrecht, Catalogus
Catalogorum, p. 111. Kumarila probably belongs to
the end of the 7th cent. a. d. He is known to San¬
kara, see Cowell in Colebrooke, Misc. Essays, I, 323 ;
on his (very doubtful) connexion with Bhartrhari, see
Pathak, Journ. Bombay Br. B.A.S., XVIII, 213 sq.
This is Tantravarttika III, 3, and the reading is in
the MS. correctly: sruter, &c. See Eggeling, India
Office catal., pp. 684 sq. Edited by Gangadhara
S'iistrin Manavalli, Benares Sansk. Series, 1882, &c.
(12 fasc. at present published). Translated, Calcutta,
1 9 ° 3 *
The text is bounded on either side by two black lines.
Former owner: on f. 1, and f. 'jo y appears: Viresva-
riyam; and in the same hand on f. 71 v : sriravis sara-
nam l so that apparently the owner was a Saura.
Measurement of binding : 12-7 x 4^ in.
No. of leaves : ii + 129 + ii blank. The two parts in
the original foliation have 71+58 leaves.
526 — MS. Wilson 277 b
S'astradipika (beginning), 15th cent.?
Contents: see Hall, Bibliog. Index, p. 173 ; Weber,
Catal., I, 175 ; Mitra, Notices, VI, 117, Bikaner catal.,
p. 552. The author was son of Yajnatman, Eggeling,
India Office catal., p. 691. Cf. Burnell, Tanjore catal.,
p. 82.
The author’s date is doubtful: the oldest commentary
dates from a. d. 1544, Hall, l.c. Cf. on 527 .
The text is bounded on either side by three red lines.
Printed in Bandit, N. S., VII-XIV, 1885-1892.
Measurement, fyc.: this is part 2 of the MS. described
under 621 .
Character: Jaina Devanagari.
527— MS. Wilson 274
Nayakaratna, 17th cent.?
Contents: this MS. contains exactly the second
half of the work, and may once have been part of the
same whole as that in Eggeling, India Office catal.,
p. 701. Cf. Hall, Bibliog. Index, p. 172; Mitra,
Notices, IV, 134, 135, VIII, 277 ; Burnell, Tanjore
catal., p. 85k.
The text is bounded on either side by two or four
dark red lines.
Parthasarathi must be anterior to the nth cent.,
since Ramanuja comments on him.
Measurement of binding: 11| X 5-7 in.
No. of leaves: i+133+ i blank. The original foliation
makes 134, there being no f. 125.
Injuries: from f. 94 onwards the right-hand top
corner of each leaf is torn off, but the letters lost have
been restored by a recent hand.
528 , 529 —mss. Mm 82, 83
Jaiminlyanyayamalavistara, A. D. 1834.
Contents: written when Bharatitirtha was Abbot of
SVngeri, Klemm, Gurupujakaumudi, p. 45. Edited by
GoldstUcker and Cowell, 1865-1878, and in the Anandd-
srama Series, 1892.
The text on ff. 1-65 is bounded on either side by
two red lines. Some five hands may be noted:
(1) 82 , ff. 1-65, (2) ff. 67-176, (3) ff. 177-324, (4) 83 ,
ff. 1-32, 229-286, (5) ff. 33-228, possibly identical
with (3). _
Measurement of binding: 107X6 in. approximately
for each volume.
No. of leaves:
82 = ii + 324 + ii blank. The original foliation
makes 65+111+43 (really 44, f. 16 being repeated) +
104 leaves.
83 = ii + 286 + ii blank. The original foliation
makes 32 + 206 (really 196, there being no ff. 140-149)
+ 58 leaves.
Bate: 82 , f. 220 v : samvat 1890 (= a.d. 1834) marga-
sirasuddha 6 bhaumavara \ This must apply pretty
accurately to the w hole.
Scribe: 82 , f. 220 v : likhitam brahmanabhuvdnlra-
majosi \ This applies to ff. 177-324 probably.
530 —MS. Wilson 01
Jaiminlyanyayamalavistara, A.D. 1833.
Contents: this MS. was probably written by tw r o
or three scribes. _____
Measurement of binding: 13^x8 in.
APPENDIX TO VOL. I (524-538)
67
No. of leaves : iv + 277 + vi blank. In the original
foliation 33 + 24+25 + 27 + 20 + 40 + 8 + 6 + 71 (really
69, as there is no f. 24, and ff. 35, 36 are one) + 24
leaves.
Bate: f. 33 v : sam 1889 ( = a.d. 1833) pau° va° 2
su 1 This has been corrected, but the correction is
illegible.
531— MS. Wilson 44
Jaiminiyanyayamalavistara, Books I-IX,
after A.D. 1820.
Measurement of binding: 16f X 6 - 1 - in.
Material: yellow country paper.
No. of leaves : ii + 154 + ii blank.
532— MS. Wilson 276
Jaiminiyanyayamalavistara, Book V, A.D. 1799.
Contents: the text is bounded on either side by
two double red lines.
Measurement of binding: 11|- x 6 in.
No. of leaves : i + 27 + i blank. The original foliation
makes 28 leaves, but there is no f. 22.
Bate: f. 27 : samvat 1855 ( = a. d. 1799) l
533— MS. Mill 107
Badarayanasutra, 18th cent. ?
Contents: the Sutras have not yet been well edited*;
best in the Anandasrama Series, 1890, 1891. They have
been translated by Deussen, Leipzig, 1887, and Thibaut,
S.B.E., XXXIV, XXXVIII, in both cases with
Sankara’s commentary, whose accuracy, however, is
attacked by Thibaut, with some reason ; see also the
preface to his translation of Ramanuja’s Bhasya,
S.B.E., XLVIII. But if Sankara is not faithful
to the letter of the Sutras, he reflects with greater
truth the spirit of the Upanisads.
Sir W. Jones began the study of this work in 1792
(f. 1). The MS. is interleaved.
Former owner: it became S. H. Lewin’s property
in 1831, and in 1838 he gave it to Mill; cf. MSS. Mill
108 ( 993 ), 109 ( 1007 ).
Measurement of binding: X 6|- in.
No. of leaves : vii + 34 + iii blank. Arranged like
a European book.
Bate: probably about a. d. 1792.
534— MS. Mill 31
Sarirakamimamsabhasya, &c., 17th cent.?
Contents : printed (with both commentaries) in Bibl.
Ind., 1863. Cf. Aufrecht, Leipzig catal., p. 276.
The text is bounded on either side by two black
lines. A good many later corrections have been made
in the margin. The writing is very small. Yellow
pigment is used for corrections.
Measurement of binding: 13^x7 in.
No. of leaves: ii + 202 + ii blank. The original
foliation has 105 + 97 leaves.
535— MS. Wilson 90
S'arirakamlmamsabhasya, Book I, A.D. 1821.
Measurement of binding : 14^ X in.
No. of leaves: iv + 209 + iv blank. The original
foliation makes 210 leaves, but there is no f. 144.
Bate: f. 209 v : sam 1877 ( = a.d. 1821) mitipusavadi
10 1
536— MS. Wilson 183
Vedantapradipa, A.D. 1821.
Contents: Ramanuja is said to have erected an
image of Narayana on the Yadava hill, a. d. 1090. His
system, resting on the old Pancaratra and Bhagavata
doctrines, reinterprets the Sutras in a realistic sense as
against Sankara’s pure idealism. According to Thibaut
{S.B.E., XXXIV, preface, XLVIII, preface), this is
a fairer interpretation than Sankara’s. Qf. Bhandarkar,
Beport, 1883,1884, pp. 71-74, Vienna Orient. Congr., Ar.
Sect., p. 100. Deussen will treat of Ramanuja in his
history of philosophy. On his date (born a.d. 1017)
see also Biihler, Vienna Orient. Journ., I, 5.
Measurement of binding: 13^ X 6f- in.
No. of leaves: ii + 157 + ii blank. The original foliation
makes 158, but there is no f. 23.
Bate: f. 157: samvamta 1877 ( = a.d. 1821) miti fear -
tika muka 14 vara atavdram 1
537— MS. Walker 222*
Badarayanasutra, A.D. 1790.
Contents: ff. 1, 24 are on yellow paper. The text
occupies the centre, the commentary the top and
bottom, of each page.
Measurement of binding : 12^ x 7^ in.
No. of leaves : ii+168 +ii blank. In the original
foliation part 1 has 24 ff.; part 2 had 151, but ff. 17-
40 are lost, and are replaced by 17 ff., the last of which
is blank.
538— MS. Wilson 389
Pancapadikavivarana, A.D. 1668.
Contents: see Hall, Bibliog. Ind., p. 88; Mitra,
Notices, V, 131, 132, Bikaner catal., p. 560; Burnell,
k 2
G8
CATALOGUE OF
Tanjore catal., p. 87, for Tadmapada, a disciple of
Sankara. The commentary is probably a 13th cent,
work ; cf. Mitra, Notices, IT, 211. Cited by Madhava,
Barth, Ind. Ant., XXV, 36, who calls it a gloss on
Vacaspati, sec the edition by Iiamasastrin Bhagavata-
carya, Benares, 1892.
Former owner : f. 144' : S ivddlksitdndm 1
Measurement of binding: j o-’- x 5 in.
No. of leaves : ii + 144 + ii bfank.
Bate: f. 144: samvat 1724 ( = a.d. 1668) samayc
naddhasavatsa (??) jyestfiasuddhadasamydni samdplam \
539— MS. Wilson 426 ’>
Fragment of Commentary on Badarayanasutra,
18th cent.?
Measurement, fyc.: this is part 2 of the MS. described
under 551 .
540 —MS. Mill 46 c
Pancadasi, A.D. 1728.
Contents : see on MS. Sansk. c. 85 (1202).
The text is bounded on either side by two double
red lines.
Measurement, fyc.: this is part 3 of MS. Mill 46
( 1043 ).
Bate: f. 217: khasuksmdpamite varse bhrgau vdrsi-
kydm l
541— MS. Wilson 88
Pancadasi, A.D. 1805.
Contents: the meaning of the colophon is correctly
explained by Klemm, Gurnpujdkaumud>, pp. 41 sq.,
as showing that Bharatitirtha and Vidyaranya, i. e.
Madhava, brother of Sayana, each had a share in the
work, cf. S'ivadatta’s preface to Yeddntddhikaranamdld,
Poona, 1891, p. 2. Ramakrsna was their contemporary,
and so flourished about a.d. 1350-1400.
The text is bounded on either side by two red lines.
The commentary is written at the top and bottom of
each page. _____
Measurement of binding : 14^x8 in.
Xo. of leaves: iii + 288 + iv blank. The original
foliation makes 292, but there are no ff. 63, 210, 244,
262.
Date: f. 288 v : sdkem 1727 ( = a.d. 1805) vaisd-
sakrsna 7 (?) somavdsare l
Scribe: f. 288 v : lipikrtam Saddsiva brdhmana Pu-
skaraksetramadhye t
SANSKRIT MSS.
542— MS. Wilson 89
Pancadasi, after A.D. 1820.
Contents : the text occupies the centre of each page,
the commentary the top and bottom.
Measurement of binding : 14 x 8 in.
No. of leaves : iv 4 -153 + iv blank.
543—MS. Wilson 470
Pancadasisamasa, A.D. 1738.
Contents: a few corrections have been made in the
beginning. _
Measurement of binding : 10 x in.
No. of leaves : i + 85 4 - i blank.
Bate: f. 85 V : samvat 1794 ( = a.d. 1738) varse
dsvinaradi 3 bhrgau dine.
Scribe: f. 8j v : Usuniti srirdjaddhamge(T) Jajdlapure 1
544—MS. Mill 62°
Aparoksanubhutisudharnava, A.D. 1810.
Contents: frequently edited in India, e.g. at Bombay
in 1878. Cf. Bendall, Brit. Mus. catal., p. 121.
Measurement, fyc.: this is part 3 of the MS. described
under 564 .
Scribe: probably identical with that of 171 .
545—MS. Wilson 531J
Aparoksanubhava, 19th cent. ?
Contents: there are corrigenda on If. 128 7 , 131.
Measurement, fyc.: this is part 3 (ff. I2i v -I34 =
ff. 53 v -66 in the original foliation) of the MS. described
under 557 .
546—MS. Mill 62 J
Atmabodha, A.D. 1819.
Contents: the text occupies the centre, the com¬
mentary the top and bottom, of each page. Some
corrections have been made with yellow pigment.
Edited by F. Neve, Paris, 1866. English translation
by J. F. Kearns, Madras, 1867; by Narasimmiah,
Madras, 1883. The commentary is attributed else¬
where, c. g. in Aufrecht, Leipzig catal., p. 280, to Ma-
dhusudana Sarasvati.
Measurement, fyc.: this is part 4 of the MS. described
under 564 .
| Bate: f. 71: samvat 1875 (= a. d. 1819) caitrasukla 7 1
APPENDIX TO VOL. I (538-556)
69
547— MS. Wilson 531^
Atmabodha, 19th cent.?
Measurement, fyc.: this is part 2 (ff. 1-28) of the
IS. described under 557 .
548 —MS. Wilson 324
Ajnanabodhini, 18th cent.?
Contents : this is the Ajnanabodhini, a short exposi-
ion of the Vedanta in the form of a commentary on
he Atmabodha, according to Hall, Bibliog. Index,
>. 105; see Eggeling, Lidia Office catal., p. 736;
vlitra, Notices, II, 678, Bikaner catal., p. 554; Weber,
JataL, II, 1171. Printed by Bergstedt, Upsala, 1850.
The MSS. appear to vary considerably. For verse 4
see on MS. Sansk. d. 165 ( 1280 ). Does Dya quote the
verse from this work as the Atmabodhavrtti ? This
seems most probable.
Measurement of binding: 12^ x 6-j in.
No. of leaves : iii + 9 + iii blank.
549—MS. Wilson 478b
Tripuriprakarana, A. D. 1681.
Contents: Weber, Catal., I, 180, calls this TriputI,
and Aufrecht in the Catalogus Catalogorum accepts this
spelling. See however Eggeling, India Office catal.,
pp. 113 (Tripuryupanisad), 737; Mitra, Notices , I, 10
(Tripuryup c ). There is a Tripuropanisad which is
different. As a commentary by Anandatirtha exists,
Bhandarkar, Report, 1883, 1884, p. 267, it is probably
genuine.
The text is bounded on either side by a broad red
line over two double narrow ones.
Measurement, fyc.: this is part 2 of MS. Wilson 478
(807).
Date : f. 42 : samvat 1737 ( = a. d. 1681) varse phdl-
gunakrsna 9 navamydm bhrgau 1
550 —MS. Wilson 531*
Dhanyastotra, 19th cent.?
Contents: printed in Brhatstotraratndkara , pp. 286 sq.
Measurement, fyc.: this is part 7 of the MS. described
under 557 .
551— MS. Wilson 426 a
Vakyasudha, A.D. 1790.
Contents : this commentary is identical with that in
Eggeling, India Office catal., p. 739; Mitra, Notices,
III, 226. Translated by Manilal Nabhubhai Dvivedi,
Bombay, 1885.
The text is a good deal corrected with yellow pigment.
Measurement of binding: 12P x 6^ in.
No. of leaves : ii + 108 + ii blank. The ten parts in
the original foliation have 104-13 + 5 (numbered 1, 2,
I_ "3) + 7 + 12 + i7 + 3 + a + 3 + ( I “3> 2-35) leaves.
552— MS. Mill 62 b
Vedantasara, after A. D. 1820.
Contents: this MS. is a good deal corrected by
means of yellow pigment.
Measurement, fyc.: this is part 2 of the MS. described
under 604 .
553— MS. Wilson 531 c
Vedantasara, 19th cent.?
Contents: the MS. has been a good deal corrected
by a later hand by means of yellow pigment. On
f. I2i v it is deliberately attributed to Sadananda. This
Sadananda may be identical, as is usually assumed,
with Sadananda Yati, the author of the Advaitabrahma-
siddhi, see Barth, Ind. Ant., XXV, 36. Cf. on MS.
Sansk. d. 163 ( 1293 ).
Measurement, tyc.: this is part 2 (ff. 96 v -i2i v =
ff. 28 v -53 v in the original foliation) of the MS. described
under 557 .
554— MS. Wilson 531^
Pancikaranavarttika, 19th cent. ?
Contents : see MS. Sansk. d. 155 ( 1283 ).
Measurement, fyc.: this is part 8 of the MS. described
under 557 .
555— MS. Mill 13
Advaitaratnaraksana, A.D. 1087.
Contents: see Eggeling, India Office catal., p. 767.
The text is bounded on either side by four red lines.
Measurement of binding: 14^x7 in.
No. of leaves : ii + 41 + ii blank.
Bate: f. 4i v : samvat 1743 ( = a.d. 1687) samayand-
ma miti margaslrsasudidvitiya l
556—MS. Wilson 449b
Bhedadhikkarasatkriya, A.D. 1055.
Contents : see Eggeling, India Office catal., p. 762 ;
Mitra, Notices, III, 94 (text only). Nrsimhasrama’s
date is given by the notice at the end of the Tattva-
viveka (Eggeling, p. 762 a ) c bdnaviyadrasemduganite , 3
70
CATALOGUE OF SANSKRIT MSS.
which surely means samvat 1605 ( = a.d. I 549)> n °t
1604 as Eggeling. Narayana, his pupil, flourished
therefore about a. d. 1600.
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 2 of MS. Wilson 449
(890).
Bate: f. II9 V : svasti srisamvat 1711 ( = a. d. 1655)
varse srdvane suklapaksasya navamyam bhaumavdsare I
Scribe: f. 119 V : Sahasrakiranenedam likhitam pusta-
kam Bhedadhikkrteb tikapustakam iti I paropakaraya
likhitam pathdrtham avalokandya 1 Visvesvararajadhd-
nydm likhitam \
557— MS. Wilson 531 ft
DvadaSamahavakyavivarana, 19th cent. ?
Contents: see Bhandarkar, Bombay catal ., p. 91
(the end differs slightly from that in this MS.); Weber,
Catal., II, 1173; Mitra, Notices, IV, 268; Hall,
Bibliog. Index, p. 205 ; Bendall, Brit. Mus. catal.,
pp. 121, 122.
The MS. is fairly accurate.
Measurement of binding : 5 X 7 in. The leaves are
arranged in European fashion.
No. of leaves: ii + 328+ i blank. Originally foliated
as 8 parts, which have 68 + 66 (+4 blank) +120 +
28 + 18 (+ 2 blank) + 13 + 1+8 leaves. All are written
by one hand.
558— MS. Wilson 531 f
Astavakrasamhita, 19th cent. P
Contents : see on MS. Sansk. d. 151 (1303). A few
corrections have been made by a much later hand.
Measurement, Sfc.: this is part 4 of the MS. described
under 667.
559— MS. Wilson 531 1 *
Vyasaiukasamvada, 19th cent.?
Measurement, Sfc.: this is part 6 of the MS. described
under 657.
560— MS. Mill 113k
S'andilyaautra, 19th cent. P
Contents: this is regarded as the chief of the
treatises on Bhakti. Edited, with this commentary,
by J. R. Ballantyne, 1861; translated by E. B. Cowell,
Bibl. Ind., 1878. Bhandarkar regards the bhaktimarga
as extremely old in India, in which view Biihler
concurs, Ind. Ant., XVIII, 189. Cf. Garbe, Samkhya
Philosophic, p.114, and his edition of the Bhagavadglta.
The text is bounded on either side by two red lines.
Measurement, See.: this is part 2 of MS. Mill 112
(1037).
561—ms. Mm 01 k
Yogasutra and Rajamartanda, A. D. 1078.
Contents: see Hall, Bibliog. Index, p. 10. Bhoja’s
commentary is based on, but much inferior to, Vyasa’s,
which belongs to the 7th cent.; see Garbe, Samkhya
und Yoga, p. 41, against Rajendralala Mitra, Yoga
Aphorisms, a translation with text {Bibl. Ind., 1881-
1883), pp. lxxix sq. On Patanjali, who is probably
the grammarian, see Garbe, Samkhya Philosophic,
pp. 26, 40 sq.
The text is bounded on either side by two red lines.
There are a few corrections by a later hand.
Measurement, 8 fc.: this is part 2 of the MS. described
under 670.
Bate: f. 98*: samvat 1734 (=a.d. 1678) caitra-
krsnapaksa 3 bhrguvasare l
Injuries: f. 1 is missing.
562— MS. Wilson 481 a
Yogasarasamgraha, after A. D. 1810.
Contents: the author is Vijnanabhiksu, see Hall,
Bibliog. Index, p. 12. His date is the second, half of
the 16th cent., Garbe, Samkhya Philosophic, pp. 74 sq.
Edited and translated by Ganganatha, Bombay, 1894.
The text is bounded on either side by two red lines,
and has been corrected to some extent, with yellow
pigment. ______
Measurement of binding: gf x 5! in.
No. of leaves : ii + 74 + ii blank. The two parts in
the original foliation have 56 + 17 leaves.
563— MS. Min 74d
Yogavasisthasara, 18th cent. P
Contents : see on MS. Sansk. c. 90 (1302).
The text occupies the centre, the commentary the
top and bottom, of each page. In ff. 50-84 the text
is bounded on either side by two double red lines.
Measurement, Sfc.: this is part 4 of MS. Mill 74
(1013).
Scribe: f. 112: likhi josi (obliterated) ramasya
pustakam Hanumamtanikate l
564 — MS. MiU 02 a
Yogavasisthasara, after A. D. 1820.
Measurement of binding : 11| x 6 j in.
No. of leaves: ii + 92 + ii blank. In the original folia¬
tion the five parts have 31 + 13+11 + 16 + 21 leaves.
71
APPENDIX TO VOL. I (556-570)
565-MS. Wilson 483
Vasisthasamhita, after A.D. 1810.
Contents: Mitra, Notices , I, 256, appears to be
fferent, though on the same topic. Said to be cited
j r Sankaracarya on Svetasvataropanisad, Aufrecht,
utalogus Catalogorum , II, 131.
Measurement of binding ; 9} x 4^ in.
Material: yellow country paper.
No. of leaves: ii +18 + ii blank.
506— MS. Wilson 482
Hathapradipika, 18th cent. P
Contents: cf. MS. Sansk. d. 149 (1308), and for
, copy with a text allied to this, Eggeling, India Office
,atal ., p. 601.
The text is bounded on either side by four red lines.
Some corrections have been made in a very barbarous
land.
Measurement of binding : 9j X 5-| in.
No. of leaves : i + 51 + i blank. The original foliation
makes 52, but f. 35 is lost.
567— MS. Wilson 337 tt
GoraksaSataka, 18th cent. ?
Contents: see Hall, Bibliog. Index, p. 18 ; Mitra,
Notices, I, 255; Burnell, Tanjore catal., p. ii2 b . The
author belongs to the beginning of the 15th cent.,
when his followers regarded him as an incarnation of
Siva, Goldstiicker, Literary Remains, I, 161. Edited
by Bhuvanacandra Vasaka, Calcutta, 1891.
The text is bounded on either side by two red lines.
Measurement of binding : ii| X 5! in.
No. of leaves : ii + 86 + ii blank. The four parts in
the original foliation have 13 + 7 + 28 (numbered 20 to
47) +38 leaves.
568— MS. Wilson 481 b
Yogaiastre Videhamuktyadikathana, A.D. 1821.
Contents: the work has been copied from an im¬
perfect MS. Ff. 60, 6o v are partially blank. On f. 62
the work begins again: atha yogab 1 mamtrayogo
mlayas caiva rajayogo hathas tatha \ yoga aturvidhali
prokto yogemis tatradiksibhih \ dsanam pranasamrodho
‘ dhyanam caiva samadhikah \ etac catustayam viddhi
sarvayogesu sammatam 11211 The rest is an amplifica¬
tion of these themes in 132 verses, of which 7-19 are
omitted, ff. 62 v , 63, 6 $ Y being blank. The MS. is
extremely inaccurate. Cf. Hall, Bibliog. Index, p. 13,
no. 20. The first five verses recur in S^arngadhara-
paddhati, 4381-4385, Aufrecht, Catalogue Catalogorum,
P- 573 a * -
Measurement, fyc.: this is part 2 of the MS. described
under 682 .
Bate: f. 74 v : bhadrapadasu 0 7 samv 1877 ( = a. d.
1821) l
Scribe: f. 74 v : li° Ramacamdrakasmirind I
Character : Devanagari with some Kasmir charac¬
teristics. Perhaps copied from Sarada.
569— MS. Wilson 184
Samkhyakarika, after A.D. 1810.
Contents : for Isvarakrsna’s date see Garbe, Samkhya
und Yoga, p. 7. He probably lived before or in the 5th
cent. Takakusu, J. R. A. S., 1905, pp. 48-50, dates him
about a. d. 450. Translated by T. Davies, London, 1881.
On Narayana see Hall, Bibliog. Index, p. 7 ; Mitra,
Notices, V, 125, III, 301; Eggeling, India Office catal,
p. 597. ‘ He is quite modern/ Garbe, Samkhya
Philosophic, p. 69. Edited by Becanarama Tripathi,
Benares Sansk. Series, no. 9.
Measurement of binding : 13I X 6-| in.
No. of leaves : i + 54+ i blank. The two parts have
8 + 47 (really 45, there being no ff. 28, 29) leaves.
Bate:
(1) f. 9 : samvat 1889 ( = a. d. 1833) margasirsa-
suklapak§anavamyam sanivasare \
(2) Looks rather older.
Scribe: only that of part 1 is given: f. 9: lisitam
Laksmana trigunayutakasyam madhyasthanam rajya-
mamdira Eanumatasamnnidhana kubham 1
570—MS. MiU 61 a
Samkhyatattvakaumudi, A.D. 1877.
Contents: of Vacaspatimisra all that is certainly
known is that he is not the famous jurist, that on the
one hand, he is known to Madhava in the Sarvadarsa-
nasamgraha and to Udayana, and that he commented
on Sankara’s commentary on the Vedantasutras, and
cites Bhoja’s llajavarttika. He is therefore probably
to be assigned to the 1 ith cent. a. d. Cowell, Kusu-
mahjali, p. x, assigns him to the 10th, but the citation
of the llajavarttika was not then known. Garbe,
Samkhya Philosophic, p. 61 note, prefers the first half
of the 12th cent. Bendall, Brit. Mus. catal., p. 120,
following Barth, dates him about a. d. 1160. This is
impossible if Udayana is dated before a. d. 991, ibid.,
p. 127, Keith, Ind. Inst, catal., p. 11. Cf. Pathak, Journ.
Bombay Br. R.A.S., XVIII, 89, 90 ; and on 609.
CATALOGUE OF SANSKRIT MSS.
Translated by Garbe, Munich, 1892; edited by
Taranatba Tarkavacaspati, Calcutta, 1871; and at
Benares, 1873 and 1902. With English translation,
Bombay, 1896.
The text is bounded on either side by two red lines.
Measurement of binding : 1 i-j x 5^ in.
No. of leaves: ii + 98 + ii blank. The two parts in
the original foliation have 45 + 54 (really 53> ^ 1 being
lost) leaves.
Date: f. 45'': samvat 1733 varse bitddrakrsnajanmd-
slamyam I
Scribe: f. 45 v : Vinayasumdarasyadvadind syudvdi-
ddmgam viedryya Sdmkhyalatvakaumudi likhita 1 ane-
kd mtasamuditd tamohanlri sydt \
Character: Jaina Devanagari.
571 —MS. Mill 71
Samkhyatattvakaumudi, 19th cent. ?
Contents : a very inaccurate MS. The colophon is:
Hi srimahdmahosddhydyavdcaspatimisrakrtd kautnudi
sasatitika samdptd \
Yellow pigment is used for corrections.
Measurement of binding : 11x4-7 in.
No. of leaves: i + 48 + i blank.
572— MS. Mill 89
Samkhyatattvakaumudi, 19th cent.?
Contents : on f. 1 is a diagram. The text is bounded
on cither side by two red lines.
Measurement of binding : 10 X 4I in.
No. of leaves: i + 36 + i blank.
573— MS. Wilson 515
Samkhyatattvakaumudi, after A. D. 1820.
Measurement of binding: 9^ X 7^ in.
No. of leaves : ii + 41 + ii blank.
574— MS. Wilson 426 f
Samkhyasutra, 19th cent. ?
Contents: for Nagesa’s work, written about the
beginning of the 18th cent., see also Hall, Bibliog.
Index, p. 2 ; Garbe, l. c., p. 79.
The text is bounded on either side by two double
red lines. -
Measurement, §c.: this is part 5 of the MS. described
under 561.
575— MS. Wilson 531 e
Paramarthasara, 19th cent. ?
Contents: Abhinavagupta flourished between a. d.
993 and 1015, see Biihler, Kasmir Report, p. 80. The
author of the commentary, according to Eggeling,
India Office catal., p. 841, was ltajanaka Yogaraja,
who was apparently a pupil of Abhinavagupta and
Ivscmaraja. On the Saiva school of Kasmir see
especially Bhandarkar, Report, 1883, 1884, pp. 76 sq.
Measurement, fyc.: this is part 3 of the MS. described
under 557.
576— MS. Wilson 407
Nyayasutra, 19th cent. ?
Contents: Vatsyayana’s Nyayabhasya was printed
at Calcutta in 1865; Kesava Sastrin translated it in
Pandit, N. S., II sq. Cf. Windisch, Uber das Nydya-
bhdisya, Leipzig, 1888. Another edition of the Sutras,
Benares, 1896. On the age of the Nyaya, cf. Muller,
Six Systems of Indian Philosophy.
Measurement of binding : 137X 6 in.
No. of leaves : ii + 73 + ii blank.
577— MS. Walker 20ld
Bhasapariccheda, 18th cent.?
Contents : the text is bounded on either side by two
black lines up to f. 58, when these are discontinued,
and the MS. is finished by a different hand.
Cf. on MS. Sansk. c. 97 (1324).
Measurement, fyc.: this is part 4 of the MS. described
under 610.
578— MS. Wilson 278'1
Bhasapariccheda, 18th cent.?
Contents : square blank as in 600. The verses are
carefully numbered. —
Measurement, fyc.: this is part 4 of the MS. described
under 600.
579 —MS. Ouseley 151 c
Nyayasiddhantamuktavali, 18th cent.?
Contents: the text is very inaccurate. F. 23'' is
blank. Cf. MS. Sansk. d. 175 (1325), and Bendall,
Brit. Mus. catal., p. 141.
Measurement of binding : ic^ x 5^ in.
Material: Indian paper.
No. of leaves: 38. This is part 3 of a volume
containing Assamese works.
APPENDIX TO VOL. I (570-586)
73
Scribe: f. 38 v : Gargr (so corrected from Gargavati '?)-
dmanivasijo 0 srikesava tasya sunundi likhito ’yam
pnthah sunuh putre tuje ravau I Raghundm likhito
am gramthah atmapathanartham va paropakdrartham \
580— MS. Wilson 402
tfyayasiddhantamuktavalidipika, after A. D. 1828.
Contents: see on MS. Sansk. c. 98 (1326). For a
ommentary by Ramarudra Bhattacarya on this com¬
mentary see Stein, Kasmir catal., pp. 336, 337. A
lahadeva, son of Balakrsna, wrote the Hikmatprakasa
1 a. d. 1774, Stein, p. 192, and may be a descendant
f the author.
Measurement of binding : 1 1J x in.
Material: the paper is water-marked c E. Wise.*
No. of leaves : ii + 238 + ii blank.
Bate: the paper is water-marked 1828.
581— MS. Walker 181s
Nyayasiddhantamanjarl, 17th cent. ?
Contents : cf. on MS. Sansk. d. 173 (1308).
The text is bounded on either side by two red lines.
Measurement, SfC.: this is part 7 of MS. Walker 181
1046).
582— MS. Wilson 418
Nyayasiddhantamala, 17th cent.?
Contents: see Eggeling, India Office catal., p. 642;
Mitra, Notices , VIII, 298, Bikaner catal. , p. 543. It
is practically a commentary on Pramanalaksana of the
Nyayasutras.
Four hands can be distinguished thus : (1) ff. 1-15,
(2) ff. 14-20 (original numbering), (3) ff. 23-50 (orig.
ff. 21, 22 are lost), (4) ff. 51—103 (really 107, as f. 74 is
quadruple, and f. 103 double). The three additional
leaves after f. 74 contain a part omitted on f. 74.
The text is bounded on either side by two double
or two single red lines.
Measurement of binding : 11^x5^ in.
No. of leaves : i+ 107+ i blank. See above for the
original foliation.
583 — MS. Wilson 507
Dravyapadarthasamgraha, A. D. 1043,
Contents: this is the Prasastapadabhasya, part I,
Dravyapadarthasamgraha. See Hall, Bibliog. Index ,
p. 64; Mitra, Notices, I, 283, V, 283 ; Eggeling, India
Office catal, p. 661. The work is old, as Sridhara
wrote a commentary on it in a. d. 991, Biihler, Kasmir ,
Report , p. 76. It does not comment directly on the
sutras individually, but gives a summary account of
the padarthas on the basis of them. For other com¬
mentaries see Peterson, Report, 1884—1886, p. 27.
Printed in Benares Sanskrit Series, 1885 sq., and,
with Sridhara’s commentary, in Vizianagram Sanskrit
Series, Benares, 1895.
The text is bounded on either side by two black lines.
The margins have the title bhd° suP.
Measurement of binding : 10J X 5^ in.
No. of leaves : iii -I- 8 + iii blank. The original folia¬
tion makes 9, but f. 3 is missing.
Bate : f. 8 V : samvat 1699 (= a. d. 1643) mdrgasirsa-
suklasastamyam budhavdsare lisatam Ndnugamgdharu
Durgddasasuta 1
Injuries : f. 3 is lost.
584 — MS. Wilson 45
Tattvacintamani, A. D. 1833.
Contents : see Eggeling, India Office catal., pp. 611 sq.;
Hall, Bibliog. Index, p. 28; Mitra, Notices, III, 166;
Burnell, Tanjore catal., p. 113. According to Mitra,
I, 285, Gahgesa lived seven centuries ago (i. e. in the
12th cent. a. d.) in Mithila. This suits well the fact
that the latest author he cites is Vacaspatimisra, whom
Cowell assigns, probably correctly, to the 10th cent.,
Kusumanjali, p. x, but who may belong to the 11th, see
on 570. Edited in Bibl. Ind., 1888 sq.
Measurement of binding: i6-| x 6 j in.
No. of leaves : ii + 77 + ii blank.
Bate : f. 77 v : amkastavasubhiwarse (=i889 = a.d.
1833, not 1834) pausamasi site dale I navamydm camdra-
vare ca \
Scnbe : f. 7 7 v : Madhavaramena likhite I
585 — MS. Wilson 278 c
Anumanacintamani, 18th cent. ?
Contents : there is a blank square in the centre of
each page, with a hole in the middle.
Measurement, fyc. : this is part 3 of the MS. described
under 600.
586 — MS. Wilson 278«>
Fragments of Anumanacintamani, 19th cent. ?
Contents: there is a blank square in the centre of
each page. The whole is written by one hand.
Measurement , fyc. : this is part 5 of the MS. described
under 000.
74
CATALOGUE OF
587— MS. Walker 198
Anumanadidhiti, 17 th cent. ?
Contents: cf. Eggeling, India Office catal. , p. 613.
Edited at Calcutta in 1848 and 1872.
From f. 145 the paper has been smeared over with
yellow pigment.
The text is variously bounded, usually by two red
lines. Four hands are perhaps to be distinguished.
F. 18 i v is illegible.
Measurement of binding : 9x5 in.
Xo. of leaves : ii + 181 + ii blank. The original folia¬
tion makes 185 ff., but ff. 12, 16, 71, 150 are lost.
588— MS. Wilson 182
• Anumanadidhiti, A. D. 1834.
Contents: ff. i-43 are written by one hand, ff. 44-
1 23 by another.
Measurement of binding: 13^x6'^ in.
Xo. of leaves : ii + 123 + ii blank.
Date: f. 123: same at 1890 ( = a. d. 1834) dsudha-
krsnatrtiydiydm munivasare \
589— MS. Wilson 178
Fragments of Anumanadidhiti, 19th cent.?
Contents: Raghunatha’s date is somewhat doubtful.
There is a tradition of some probability that he was
a contemporary of Raghunandana, the legal writer
(about a. d. 1520), Colebrooke, Two Treatises on
Inheritance , p. xii; Cowell, Colebrooke’s Essays, I, 284
note; Mitra, Notices, I, 286, who gives a sequence
from Jayadhara (beginning of 15th cent. V), Vasudeva,
Raghunatha, SVirama, Mathuranatha (about a.d. 1600).
This is probable enough in itself.
Every page has a blank square in the centre, with a
hole in the middle. At least six hands can be dis¬
tinguished : (1) ff. 1—53, (2) ff. 54-65, (3) ff. 66-70, (4)
ff. 71-105, (5) ff. 106-113, (6) ff. 114-145.
Measurement of binding: 15^ X 5 in.
No. of leaves : ii + 145 + iii blank. The numbering
in the original foliation is intelligible only up . to 107
( = f. 105, ff. 60, 66 being lost).
590 —MS. Wilson 8
Anumanatippani, A.D. 1738.
Contents: see Eggeling, India Office catal., p. 634;
Hall, Bibliog. Index, p. 29 ; Mitra, Notices, I, 285,
1J I, 108. Only extracts have as yet been published.
SANSKRIT MSS.
In the centre of each page is a blank square with
a hole in the centre. Ff. 64, 66, 81 do not belong
to the original hand. _
Former owner: f. iii: purchased, 16 May, 1823,
II. H.W.
Measurement of binding : i8| x 5 in.
No. of leaves: iii + 244 +ii blank. The original
foliation makes 248, as ff. 64, 66, 81 are later additions,
and from f. 116 the numbering goes to f. 124.
Date : f. 244: sake nagesutarkansadhipatigunite 1 i. e.
1658 (= a.d. 1736) I 8 5 6
591— MS. Wilson 10
Anumanatippani, 18th cent. ?
Contents: in the centre of each leaf is a square
blank space, with a hole in the centre, in imitation
of palm-leaf MSS.
Measurement of binding : igfx 4-7 in.
Material: country paper, somewhat absorbent,
partly yellow.
No. of leaves: ii+195 + ii blank. The original folia¬
tion is not consistent.
592— MS. Walker 123
Fragments of Anumanatippani, A. D. 1770.
Contents: apparently all of this MS. is by one
hand, but it is very much confused. The old foliation
runs to io5( = f. 101 of the new); then come ff. 81-89;
then (possibly by another hand) 43 unnumbered leaves.
The text is bounded on either side by two red lines.
Measurement of binding iox 5^ in.
No. of leaves : ii + 153 + ii blank.
593-595— MSS. Wilson 179-181
Anumanamanidldhititippanl, A.D. 1781.
Contents: Jagadisa’s date is fixed by the fact that
a pupil of his copied a MS. of his Kavyaprakasaraha-
syaprakasa in sake 1579 ( = a.d. 1657, not 1649 as
Aufrecht, Catalogus Catalogorum, p. 194, puts it: it
is sake randhrddrivbnaksitipariganite ), Mitra, Notices,
1Y, 225.
See for this work Eggeling, India Office catal.,
pp. 625 sq.; Hall, Bibliog. Index, p. 35; Mitra, Notices,
II, 335, IV, 124; Burnell, Tanjore catal., p. n6 b .
In 179, ff. 24-35 of part 2 have been replaced by
ff. 24-30 in a recent hand. So also in 181, ff. 88-110.
APPENDIX TO VOL. I (587-602)
The text is bounded on either side by two double
red lines. _^ ——
Measurement of binding: 13^ X 5-5- in.
No. of leaves:
170 = ii +220 + ii blank. In the original foliation
57 (really 58 , f. 47 being repeated )+146 (really 139 , as
there are no ff. 105 , 113 , and ff. 24—35 are represented
by only 7 new leaves) +22 (really 23 , as f. 12 is repeated).
180 = ii + 150 + ii blank. In the original foliation
47 (really 49 , as ff. 8 , 20 are repeated) + 108 (really 100 ,
as there are no ff. 90 - 99 , and ff. 15 , 54 are double).
Also a loose leaf is bound in as f. 43 of the volume.
181 = ii + 242 + ii blank. In the original foliation
108 (really j 10 , as ff. 21 , 59 are repeated)+ 40 + 92 .
Date :
( 1 ) 179, f. 58 v : samvat 1837 ( = a.d. 1781 ) miti
asadhamase krsnapakse caturthiydm bhumlvasare 1
( 2 ) 180, f. 150 v : samvat 1837 (corrected from
1 836 ) pusamdse krsnapakse dasamiydm budhavdsare \
596—MS. Wilson 9
Part of Anumanamanididhititippani, 18th cent.?
Contents: in the centre of each page is a square
blank space in imitation of palm-leaf MSS. Apparently
the whole is written by one hand in diverse styles,
though possibly ff. 125-176 are older than the rest.
Measurement of binding : 19] x 47 in.
Material: country paper, somewhat absorbent,
partly yellow.
No. of leaves: ii+ 176 +ii blank. The original folia¬
tion is not regular.
597—MS. Walker 137°
Pramanyavadarahasya, chap, i, 18th cent. ?
Contents: for Bhavananda see Aufrecht, Catalogus
Catalogorum , p. 399. The probability is that he is
posterior to Jagadlsa (a.d. 1625).
Measurement , fyc.: this is part 3 of the MS. described
under 768.
598—MS. Walker 137 b
Uttarapaksavada (Anumanacintamani), A.D. 1770.
Contents: the text is bounded on either side by
a red line. ^.
Measurement , 8fc.: this is part 2 of the MS. described
under 768.
599— MS. Wilson 177 d
Kusumanjali, after A.D. 1810.
Contents: Udayana commented on Vacaspatimisra,
and is quoted by Raghava Bhatta, a.d. 1262, Hall,
Bibliog. Index, p. 26, and by Madhava. He therefore
belongs at latest to the 12th cent. a. d., Cowell, Kusu-
mahjali with the commentary of Hariddsa , Calcutta,
1864, p. x. According to Gandrakanta (pp. 19, 20) he
is anterior to Sridhara, a. d. 991, and in the Bauddha-
dhikkara, Calcutta edition, sake 1822, Udayana’s date is
given as tarkdmbardmkapramitesv atitesu Sakdntatafi 1
which gives a. d. 984, Haraprasada, Iieport , 1891—
1895? P- I 3- On the date see also Pathak, Journ.
Bombay Br.B.A.S., XVIII, 90; and cf. on 570.
Edited with Vardhamana and Rucidatta’s commentaries
by Candrakanta Tarkalamkara, Calcutta, 1888 sq.; also
Calcutta, 1889, with Haridasa.
Measurement, Sfc.: this is part 4 of the MS. described
under 601.
600— MS. Wilson 278 ft
Kusumanjali, A.D. 1847.
Contents : in the centre of each page is a square
blank space with a small hole in the centre, in imitation
of the style of palm-leaf MSS.
Measurement of binding: 13^X4^11.
No. of leaves: i + 177 + ii blank. The five parts in
the original foliation have 26+11 + 72 (not numbered)
+ 9 + 59 (not consecutively numbered) leaves.
Scribe: parts 1 and 2 are by the same hand; part
4 possibly by this hand; parts 3 and 5 by quite
different hands.
601— MS. Wilson 177*
Commentary on Kusumanjali, after A. D. 1810.
Contents: it appears that the author was Ramabha-
dra Sarvabhauma, Mitra, Notices, II, 4; Hall, Bibliog.
Index, p. 84. As he quotes Vardhamana, of whom
Hall, p. 83, mentions a MS. of a.d. 1565,1ns date
is probably not earlier than the 17th cent.
Measurement of binding : 167 x 6^ in.
Material: yellow country paper, except ff. 35-41.
No. of leaves : i + 44 + i blank. The four parts have
3 1 + 3 + 7 + 3 leaves.
602— MS. Wilson 177 b
Fragment of Commentary on Atmatattvaviveka,
after A.D. 1810.
Contents: for Raghunatha’s probable date see on
589. On this commentary see Hall, Bibliog. Index,
l 2
7(3
CATALOGUE OF
p. 82; Mitra, Notices, III, 49, 333; its usual name
is Bauddhadhikkaradidhiti.
Measurement, Sfc .; this is part 2 of the MS. described
under 601.
003—MS. Wilson 278 b
Muktivadavicara, 18th cent. ?
Contents: there is a hole in the centre of each leaf,
as in 600. -
Measurement, §c.: this is part 2 of the MS. described
under 600.
604 —MS. Wilson 177 c j
Commentary on Badarayanasutra (Book IV, chap. 4),
10th cent.?
Measurement, fyc.: this is part 3 of the MS. described
under 601.
005—MS. Walker 200^
Tarkasamgraha and Tarkasamgrahadlpika, A.D. 1776.
Contents: the author is called Ananta Bhatta in
two MSS., Aufrecht, Leipzig catal., p. 292. Both
text and commentary have been often printed, e. g. by
Kasinatha Panel uranga Paraba, fourth edition, Bombay,
1899, with English translation, and at Foona in 1903.
The MS. is much corrected by a later hand. The
text is bounded on cither side by two red lines.
Measurement, Sfc.: this is part 2 of the MS. described
under 411.
Date :
(1) f. 40 v : samvat 1832 (= a. d. 1776) asadhasudi
7 vudhe \
(2) f. 52 v : samvat 1832 dsd(lhasuda 13 bhaumc 1
Scribe :
(1) f. 40 v : agnihotrivyasatulasi tasydtmajabhu-
devandmna vilikhitam asti l
(2) f. 52 v : agnihotrivyasatulasi l sutabhudevapa-
thandrlham 1 It must be noted that there is very
considerable difference in style between this and 186.
Character: Devanagarl with some traces of Jaina
characteristics.
606—MS. Walker 205e
Tarkabhasaprakaiika, A. D. 1659.
Contents: see Weber, Catal, II, 189 sq., where
(’ihna° is the form of the name. Cinna° is given in
Bhandarkar, Report, 1882, i883,p. 144, no. 285. Which
llariharawas his patron is not clear, but he must have
lived at Vijayanagara in the latter half of the 14th cent.,
cf. Bhandarkar, p. 26; Burnell, Tanjore catal., p. 118 ;
W internitz, R.A.S. catal., p. 136.
SANSKRIT MSS.
The text is bounded on either side by two double
red lines. In the centre of each page is the usual
Jaina figure, partially filled in with letters.
Measurement, fyc.: this is part 5 of the MS. described
under 238.
Date: f. 122: samvat 1715 ( = a. d. 1659) varse
asadhasudi purnimdtithau suklapakse sukravdsare l
Character: Jaina Devanagarl.
607—MS. Walker 180f
Fragments of Commentary on Tarkabhasa,
A.D. 1770.
Contents: ff. 97, 105, 107 are of yellow paper.
One or two comments in Telugu writing are added.
Measurement of binding : 11x6^ in.
No. of leaves : ii + 127 + ii blank. Originally foliated
in seven parts as follows : f. 1 contains scraps ; ff. 2-13
( = orig. 1-12) are part 1 ; ff. 14-28 ( = orig. 1—15) are
part 2; ff. 29-50 (= orig. 1-25, ff. 15, 18, 19 being
lost) are part 3 ; ff. 51-65 ( = orig. 1-10, and 1-5) are
part 4; ff. 66-94 (= orig. 1-28, f. 7 being repeated)
are part5; ff. 95-108 ( = orig. 15, 16, 21-32) are part 6;
ff. 109-127 (original foliation confused) are part 7.
608— MS. Walker 201^
Atmatvajativicara, A.D. 1780.
Contents: see Hall, Bibliog. Index, p. 47, and, for
a list of the author’s works, Aufrecht, Catalogus
Catalogorum, p. 437. Mahadeva was a native of
Puntambem in the Ahmadnagar district, Bhandarkar,
Report, 1883,-1884, p. 82.
Up to f. 135 the text is bounded on either side by
two double red lines. In the middle of f. 135 a new
hand begins, and continues to the end. The gramtha-
samkhya is 430. ___.
Measurement, fyc.: this is part 8 of the MS. described
under 610.
Sci'ibe: f. 138"^ : likhito’yampdthakadurlabhardimena\
609— MS. Walker 180“
SadrSyavada, A.D. 1709.
Contents: the work begins on f. 2 V , and ends on
f. i3 v . F. i9 v is nearly all blank, but none of the
text has been lost. ___
Measurement , fyc.: this is part 1 of the MS. described
under 607.
Date: f. i3 v : samvat 1855 ( = a.d. 1799) vaisdkha-
suklapak§e I
APPENDIX TO VOL. I (C 02 -G 18 )
610— MS. Walker 201 a
Dharmitavacchedakatapratyasattivicara,
A.D. 1780.
Contents: cf. Eggeling, India Office catal., p. 647.
The text is occasionally bounded on each side by
ne or two black lines. On f. 1 some scraps in bhasa
re written.
Measurement of binding : iof X 5J in.
No. of leaves: ii +148 + ii blank. The nine parts in
;he original foliation have 35 + 8 + 8 + 8 + 14+17 (really
[8, as f. 3 is double)+ 27 +13 + 9 leaves, and a blank
!eaf after each part.
611— MS. Walker 180e
Navinamatavicara, A.D. 1770.
Contents: the opinions refuted are on anumana,
Eggeling, India Office catal., p. 647. See Mitra,
Notices, VII, 140; Hall, Bibliog. Index, p. 53 ; Hrsi-
kesa, Sansk- Coll, catal., Ill, 221, 222; Winternitz,
R.A.S. catal., p. 146.
The text is bounded on either side by a red line.
It is not very accurate.
Measurement, fyc.: this is part 5 of the MS. described
under 607.
612— MS. Walker 180°
Navinamatavicara, 18th cent. ?
Contents: the MS. is badly and inaccurately written.
Measurement, fyc.: this is part 3 of the MS. described
under 607.
613— MS. Walker 128 d
Ratnako6akarikavioara, 18th cent.?
Contents: the text is bounded on either side by
two double red lines. The MS. is complete, ending
with the words : iti Ratnakosakarikavicarah samdptah 1
F. 131 is blank.
This work is described by Hi;sike3a, Sansk. Coll, catal.,
Ill, 302, as a commentary on the Anumanakhanda.
Measurement, fyc.: this is part 4 of the MS. described
under 785.
614— MS. Walker 201 *
Laukikavisayavicara, A.D. 1780.
Contents: cf. Mitra, Notices, I, 77, where also the
work is anonymous; Winternitz, R.A.S. catal., p. 146.
The text is bounded on either side by two double
red lines. _
Measurement, fyc.: this is part 9 of the MS. described
under 610.
Scribe: different from that of 008.
615— MS. Wilson 405
Pratyaktattvadlpikatlka, 17th cent. P
Contents : this work is really a commentary on
Citsukha’s Pratyaktattvadipika, a refutation of the
Nyaya doctrine on the basis of the Yedantasutra;
its author was Pratyaksarupa; Hall, Bibliog. Index ,
p. 154 ; Mitra, Notices, III, 87 ; Aufrecht, Flor. catal.,
p. 72 ; Garbe, Tubingen catal., p. 44.
Citsukha quotes Vacaspati, and is anterior to the
Samksepasamkaravijaya (about a. d. 1350), see Bodl.
catal., p. 254; Thomas, R.A.S. catal., p. 291. He
therefore flourished about a.d. 1300.
The gramthasamkhya 3065 is given on f. 45^.
The text is bounded on either side by three or four
red lines. _____
Measurement of binding : 12 j X 4^ in.
No. of leaves : i + 45 + i blank.
616— MS. Walker 102°
Akhyatavadavivecana, 18th cent. ?
Contents ; B : probably this work is identical with
one of the commentaries mentioned by Hall, Bibliog.
Index, p. 62; Stein, Kasnur catal., p. 147; but the
lack of extracts prevents identification. The work
commented on is probably S'iromanPs.
A: this appears from the beginning to be a com¬
mentary either on Slromani’s Akhyatavada, or on
a very similar work.
Measurement, fyc. : this is part 3 of the MS. described
under 207 .
617— MS. Walker 180 d
Nanvadatippani, A.D. 1780.
Contents : see on MS. Sansk. c. 96 ( 1321 ). This
MS. is a good deal corrected.
The text is bounded on either side by two double red
lines. Ff. 11-15 have apparently been supplied by
a later hand.
Measurement, fyc.: this is part 4 of the MS. described
under 607,
618— MS. Walker 18Qt>
Karakavada, 17th cent. P
Contents : the MS. seems to be accurate.
The text is bounded on either side by three or four
red lines. _______
Former owner : f. 14: Somayajiviresvarabhattasya \
Measurement, fyc. : this is part 2 of the MS. described
under 007 .
CATALOGUE OF SANSKRIT MSS.
7S
619 —MS. Wilson 493 e
Part of Padavakyaratnakara, A. D. 1800.
Contents: see Hall, Bibliog. Index, p.56; Eggeling,
India Office catal., p. 654.
The text is bounded on either side by two broad red
lines. Ff. 89, 90 have been written by a different hand.
Measurement, Sfc.: this is part 5 of the MS. described
under 507.
620—MS. Wilson 501 a
Khandauakhandakhadya, after A. D. 1880.
Contents: see MS. Sansk. c. 93* (1482). An Anir-
vacaniyakhandana begins with exactly the same verse,
Stein, Kasmir catal., p. 323.
Measurement of binding : 10^-x 7 in.
No. of leaves : iii+100 + iii blank. The two parts
have 64 + 36 leaves. Arranged like a European book.
621— MS. Walker 180"
Parts of Commentaries on Anumanacintamani and
Anumanacintamanididhiti, 18th cent. ?
Contents: ff. iii v , H9 V , I26 v are blank. F. 107 is
of yellow paper. Two or three hands may be dis¬
tinguished. _____
Measurement, fyc.: this is part 7 of the MS. described
under 007. .
622— MS. Wilson 171
Sarvadarsanasamgraha, A. D. 1821.
Contents: most likely the work belongs to both
brothers, to judge from the words in the preface.
The text has been again printed by Taranatha
Tarkavacaspati, Calcutta, 1872, and in another Indian
edition without place or date. Translated by Cowell
and Gough, London, 1882. The MS. has been cor¬
rected here and there.
Measurement of binding : 14^ x in.
No. of leaves : ii + 91 + iii blank.
lJatt: f. 91: samvat 1877 ( = A. D. 1821) bhadrapada-
krsna 13 guruvura \
Scribe: f. 9 x : lisatam Laksamana brahmana l
623— MS. Mill 52
Sarvadarsanasamgraha, after A. D. 1830.
Contents: lacunae are marked on ff. 8, ji.
Measurement of binding : I 2 j- X 5]- in.
No. of leaves : i + 111 + ii blank.
624—MS. Wilson 348“
S'ankaravijaya, A. D. 1820.
Contents: Burnell, Tanjore catal., p. 96, says:
‘ This seems to be a quite modern work written in the
interest of the schismatic mathas on the Coromandel
coast, which have renounced obedience to the Qrihgen
niatha, where Qankaracdrya’s legitimate successor
resides.’ Cf. Hall, Bibliog. Index, p. 167.
Printed at Madras, 1867 ; and by Jlvananda Vidya-
sagara, Calcutta, 1881. It has no claim to belong
to the real Anandagiri (13th cent.), and the mere
quotation of the Adhikaranaratnamala assigns the
writer to a date after Bharatitirtha (14th cent.).
Cf. Ind. Ant., XXV, 35, note 10.
Measurement of binding : 13-7 x 6-7 in.
No. of leaves : ii + 206 + ii blank. The two parts
in the original foliation have 112 + 95 (really 94, as f. 10
is lost) leaves.
625—MS. Mill 30
S'ankaravijaya, after A. D. 1830.
Measurement of binding : 14 x 7 in.
No. of leaves: ii + 105 + ii blank.
626—MS. Wilson 348»>
SamksepaSankarajaya, 18th cent.P
Contents: Burnell, Tanjore catal., p.. 96, points
out that this gives the Malayalam legend, which is
the orthodox one as opposed to that of the pseudo-
Anandagiri (624). There is no reason to question the
ascription to Madhava, as it need not be copied from
624, but this is not very probable, as the author calls
himself Abhinavakalidfisa, a title not elsewhere used
of him, and the work was written in the lifetime of
Vidyatirtha, Klemm, Gurupujakaumudi, p. 46. It is
more probable that 020 is antecedent to 024 than the
reverse, as Aufrecht says. Cf. Ind. Ant., XXV, 36.
Measurement, fyc.: this is part 2 of the MS. described
under 624.
627—MS. MiU 19
Samksepaiankarajaya, after A. D. 1820.
Contents: text and commentary were printed at
Bombay in 1864. The text occupies the middle, the
•commentary the top and bottom, of each page. The
slokasamkhya is given for each sarga of text and
commentary. On ff. 231-243 text and commentary
ai’c mixed up. _
Measurement of binding: 14^x9 in.
APPENDIX TO VOL. I (619-637)
79
No. of leaves : ii + 287 + ii blank. Originally each
anto was foliated separately, having 13 + 14 + 11 + 20
r 31 +17 + 16 + 24 + 13 +18 + 9+ 13 +9+ 18 + 48 + 13
eaves.
628— ms. Mill e
SamksepaSankarajaya, after A. D. 1820.
Measurement of binding : i 6£ x 5§ in.
Material : yellow country paper.
No. of leaves : i + 96 + i blank.
629— MS. Mill 41
Vidvanmodatarangim, after A. D. 1810.
Contents : printed at Calcutta in 1872.
The text is written only upon the verso, the recto
being blank, and a whole line is given to each pada.
Measurement of binding : 13 j x 8 j in.
Material: paper water-marked ‘ S. Wise & Patch/
No. of leaves: vi + 125+iii blank. Arranged like
a European book.
Bate: the latest date in the water-mark seems to be
1807.
630— MS. Mill 55
Yajnavalkya Dharmasastra, 10th cent. ?
Contents: the date of Yajnavalkya's code is known
to be not before 250 a. d. from the astronomical evidence,
Jacobi, Z.D.M. G., XXX, 306 sq., and not after the 5th
cent, because of its priority to the other law books, Jolly,
Recht und Sitte, p. 21. It belongs to the Vajasaneyins.
Edited with English translation by V. N. Mandlik,
Bombay, 1880, and in Anandasrama Sanskrit Series,
1903, 1904.
The text is bounded on either side by two red lines.
Some notes in pencil and ink are probably by Mill.
Measurement of binding : 12^ x 7-5- in.
No. of leaves : ii -1- 47 + ii blank.
631— MS. Wilson 103d
Fragment of Mitaksara, 19th cent. ?
Measurement , fyc.: this is part 4 of the MS. described
under 718. It was formerly bound up as f. 181 of the
volume. It is now f. 217^.
632 — MS. Wilson 100
Commentary on part of Mitaksara, 19th cent. P
Contents: LaksmidevI Payagunde perhaps wrote
under her son's name. She lived before a. d. 1782,
probably about a. d. 1750, see Jolly, Tagore Law
Led., 1883, p. 15 ; Z.B.M.G ., XLYI, 270; Eggeling,
India Office catal., p. 370 ; Jolly, Recht und Sitte, p. 32.
The MS. is written by several hands.
Measurement of binding : 14 X 6 ~ in.
No. of leaves: ii + 354+ ii blank. In the original
foliation there are 240+114 leaves.
633— MS. Wilson 32
SubodhinI, after A. D. 1810.
Contents: Visvesvara wrote at Kastha, north of
Delhi, under Madanapala, about a. d. 1350-1360,
Jolly, Rechte und Sitte, p. 32.
For this work cf. Burnell, Tanjore catal., p. 127.
Measurement of binding : 16 J X 5 in.
No. of leaves: ii+155 (really 154, there being no
f. 143 in the new foliation) + ii blank.
634— MS. Wilson 103°
Fragment of Subodhinl, after A. D. 1805.
Measurement, fyc.: this is part 3 of the MS. described
under 718.
635— MS. Wilson 103e
Mitaksarayah Siddhantasamgraha, 19th cent. ?.
Measurement, fyc.: this is part 5 of the MS. described
under 718.
636, 637— MSS. Walker 172, 173
Parasarasmrtivyakhya Madhavlya,
vol. I, ff. 1-274, 10th cent., ff. 275-332, A. D. 1702;
vol. II, A. D. 1700.
Contents: printed at Madras in 1875; Bibl. Ind.,
1883, &c.; and Bombay Sanskrit Series, 1893—1898,
the last being the best edition. Translated, Bibl. Ind.,
1887. Cf. Eggeling, India Office catal., pp. 375 sq.;
Jolly, Recht und Sitte, p. 33.
Four hands at least must be distinguished: (1) 172,
ff. 1-274; (2) 172, ff. 275-332; (3) 173, ff. 1-229
(several pages are doubtful, e. g. ff. 1-4); (4) 173, ff. 230-
241 ;
This was Madhava's first independent work, and
dates from before a. d. 1337, 1338, as shown by
Klemm, Gurupujakaumudi, pp. 43-45.
Measurement of binding: i2X6|in. approximately
for each volume.
No. of leaves : 172 = ii + 332 + ii blank; 173 = ii +
241+ii blank. The original foliation is: ff. 1-275 (ff*
74> 75 one leaf) + ff. 11—68, also numbered ff. 106—
160 (ff. 113, 123, 134 being repeated) + ff. 261-500
(f. 409 repeated).
so
CATALOGUE OF SANSKRIT MSS.
Date : part 2 is dated on f. 332 V : samvata 1759 nd
sake 1624 ( = a. d. 1702) pravarttamdne srdvanasiuli
3 r/waw likhitam 1 The scribe’s name is obliterated.
638, 639-mss. mui 129 , 130
Parasarasmrtivyakhya Madhaviya, 19th cent. ?
Contents: apparently nine scribes have shared in
the writing: (i) 129, ff. i, 2, 130, ff. 319-321 ; (2)
129, ff. 3-161 ; (3) 129, ff. 162-250, 130, ff. 211-303 ;
( 4 ) 130, ff. 1-54 J (5) WO, ff. 55-79 v i 0) 130, ff. 79 V-
J 73 ; ( 7 ) 130, ff. 174 - 178 ; ( 8 ) 130, ff. 304 - 318 ; ( 9 )
130, ff. 179-210. Only in 129, ff. 162-250, is there a
blank space in the centre of each leaf.
Measurement of binding : 20^ X 3j in. approximately
for both volumes.
No. of leaves:
129 = i 4-250 4-i blank. In the original foliation
2+1714-77 leaves. Also numbered consecutively on
the left-hand margin.
130 = i + 32i+i blank. In the original foliation
they arc numbered 249-551 on the left-hand margin +
18. Ff. l—79 v are also so numbered on the right-hand
margin.
640— MS. Wilson 213 ft
S'ankhaprokta Dharmasastra, after A. D. 1810.
Contents: see Eggeling, India Office catal., p. 397 ;
and the text in the Calcutta Dharmasdstrasamgraha,
II, 343-374. With the former this MS. seems to be
closely related in text, but it is a copy of India Office
MS. 84°, not of 913°. This is relatively an ancient
smrti, being cited in Mitaksara, Madhava and Jimu-
tavahana; see Jolly, Itecht und Sitte, p. 11.
Lacunae are marked on ff. 9, n v , 12.
Measurement, §c.: this is part 1 of MS. Wilson 213
(1070).
641— MS. Walker 129 «
Karmavipaka, A.D. 1772.
Contents : cf. Mitra, Bikaner catal., p. 403, Notices,
II, 4, which has 87 adhyayas; Eggeling, India Office
catal., p. 400; printed in the Dharmasdstrasamgraha,
u > 435-455;
The text is bounded on either side by two red lines.
Measurement, fyc.: this is part 5 of the MS. described
under 98.
Date: f. 209 v : sainvat 1828 ( = a.d. 1772) pausavadi
9 some likhitam 1
Scribe: f. 2C>9 V : agnihotrivyasasri 5 tulasl tasyatma-
jabhudevandmnd vilikhitam asti I Usual style with
some Jaina characteristics.
642— MS. Wilson 202
Kalanirnaya or Kalamadhaviya, A. D. 1810.
Contents: this work was composed by Madhava
under the abbacy of Vidyatirtha, as minister of Bukka,
who was reigning contemporaneously with Harihara I,
his elder brother, in a. d. 1337, 1338, Kielhorn, Golf.
GelehrteNacht., 1892, p. 109; Klemm, Gurupujdkaumudi,
pp. 44 sq. It used to be assigned to a. d. 1360,
Eggeling, India Office catal., p. 529. Aufrecht, Leipzig
catal., p. 149, still assigns it to Sayana.
Edited by Candrakanta Tarkfilankara, Bibl. Lid.,
1885-1888. _
Measurement of binding : ic+ X 9^ in.
Material: paper water-marked £ Budgen & Wilmott.’
No. of leaves : ii+ 104 + ii blank. Arranged like a
European book.
Date : f. io4 v : samvata 1877 (a. d. 1821) I srdvana-
sya krsne pakse dvitlyd ravivdsare I
Scribe: f. 104'': Oyi/sensd/ievasydrthe Sahkaraldlo
9 py alilikhata Hill
643— MS. Wilson 24*
Danakaumudi, after A.D. 1810.
Contents: see Eggeling, India Office catal., p. 549.
F. 65 has a list of contents.
Measurement of binding: 20 x 4 | in.
Material: rough yellow country paper.
No. of leaves: ii + 179 + ii blank. The original
foliation makes 65+102 + 12 leaves.
644 — MS. Wilson 28
S'uddhikaumudi, after A.D. 1820.
Contents: Govindananda is posterior to Sulapani
(16th cent., see on 600), and is probably of the 17th
cent.
Measurement of binding: 19-7 * 5f in.
Material: yellow country paper.
No. of leaves : ii + 95 + ii blank.
645— MS. Wilson 221
Vyavaharadldliiti, after A.D. 1820.
Contents: his patron was really Baz Bahadur
Candra, a prince of Kumaon, from a. d. 1644 to 1664
at least, Z.D.M.G., XLVI, 277 sq. For this work
see Eggeling, India Office catal., pp. 441 sq.; Burnell,
Tanjore catal., p. 128; for this part, Mitra, Notices,
I, 196, II, 21. The author is of some account in the
Maratha country, West and Biihler, Digest, 3 I, 24.
Measurement of binding : 12$ X 7^ in.
APPENDIX TO VOL. I (637-652)
81
Material : paper water-marked ‘ G. Dickinson.’
No. of leaves: ii + 44 + i blank. Arranged like a
luropean book, and originally paged.
Bate: the latest date in the water-mark is 1826.
646— MS. Wilson 206
Vivadacintamani, A. D. 1799.
Contents : translated by Prossonno Coomar Tagore,
Jalcutta, 1863, Madras, 1865.
Measurement of binding : 12-f X 4^ in.
No. of leaves : ii + 50 + ii blank.
Bate: f. 50: ekadvisaptaikavinidhyamanasakabda-
naghannamati varse{'() I This is certainly a. d. 1799.
Scribe: f. 50: Bhiresvaro Bhithikrtddhikavaso Viva-
lacintamanim alilekha l
647— MS. Wilson 103 b
Vivadacintamani, 19th cent. P
Measurement, fyc. : this is part 2 of the MS. described
under 718.
648— MS. Wilson 203 b
Dvaitanirnaya, A.D. 1813.
Contents : .Vacaspatimisra’s date has been put back
a hundred years by the identification of the princes
he cites. The genealogy is :
Harinarayana married Jaya (for whom the
or Bhairavasimha Cintamani and
(reigned Dvaitanirnaya
A. d. 1506-1520) were written)
Ramabhadra Rupanarayana Garuda Narayana.
(reigned a.d. 1520-1532).
One of these must be the Purusottama here men¬
tioned, Eggeling, India Office catal. , p. 876. As these
dates are probably correct, they dispose of the ordinary
view which places him a. d. 1400, Jolly, Recht und
Sitte, p. 36, Z.B.M.G., XLVI, 273; Sarvadhikari,
Tagore Law Led., p. 398. They agree with the tradition
in Colebrooke, Essays , 2 I, 471, that ten generations
had passed since his life. Cf. too Mitra, Notices, III,
35, who assigns him to sake 1423 ( = a. d. 1501). His
Cintamani must therefore have been composed about
a.d. 1510. See also on 708 for Candrasimha, father
of Harinarayana. Vacaspati’s date is also discussed by
Rocca, I Qiudizl di Bio, Livorno, 1904.
A Suddhinirnaya, of which a MS. was written in
samvat 1416 ( — a. d. 1360), is ascribed to a Vacaspati
in Mitra, Notices, X, 58. If the date be correct, it
■ODL. SANS. CATAL. APP.
confirms Aufrecht’s belief in the existence of at least
two jurists named Vacaspatimisra.
Measurement, fyc. : this is part 2 of the MS. described
under 092.
Bate: f. H4 V : sakabdah ij 35 ( = a.d.i8 13) jyestha-
sukladvadasyam \
Scribe: f. U4 V : sripitdmbarabhattdcaryyena likhito
’yam Dvaitanirnayah 1
649— MS. Walker 200*
Dravyasuddhidipika, A.D. 1770.
Contents : the text is bounded on either side by
two red lines. ___
Measurement, fyc. : this is part 5 of the MS. described
under 411.
650— MS. Wilson 218
DvaitapariSista, A.D. 1813.
Contents : if Kesavamisra’s paramaguru was Vacas¬
pati, he cannot have flourished earlier than in the 16th
cent. He is quoted by Ratnapani, Mitra, Notices,
IV, 44. Ibid., Ill, 186—188, a work is mentioned with
the same title as this, but occupying 232 ff. Cf.
Eggeling, India Office catal., p. 488. The difference
need not be very great.
Measurement of binding : 1 ij x 9! in.
Material : paper water-marked c G. Jones.’
No. of leaves : ii+133 + ii blank. Arranged like a
European book.
Bate: f. I33 v : sake 1735 ( = a. d. 1813)1 saurabha-
drasya suklapakslyasravanadvadasyam kujavare madhya-
hnasamaye \
Scribe : f. 133 7 : likhitam sripitdmbarasarmmana \
651, 652— MSS. Walker 174, 176
Madanaparijata, A.D. 1802.
Contents : the date of the work lies probably
between a. d. 1360 and 1370, under Madanapala of
Kastha, near Delhi, Eggeling, India Office catal., p.414;
Bhandarkar, Report, 1883, 1884, p. 47 ; Biihler, Manu,
p. cxxv, note ; Jolly, Recht und Sitte, p. 36.
176, ff. 239-241 v form an index.
Edited by Madhusfidana Smrtiratna, Bibl. Ind.,
1887 sq. Verses 1-14 are identical with the beginning
of the Tithinirnayasara by the same author, Stein,
Kasmlr catal., p. 306._
Measurement of binding : 1 1-| x 6 f in.
No. of leaves: 174 = ii + 244 + ii blank ; 176 = ii + 241
+ ii blank. Originally foliated consecutively, making
485 leaves.
M
82
CATALOGUE OF SANSKRIT MSS.
Date: 175, f. 2 3«S V : srimannrpavikramdrkasamayd-
tita 1858 sdlivdhanasake 1724 ( = a. d. 1802 ) pausasukla
3 guruvdsare l
Scribe: 175, f. 238V: Medapdthakajnbliyajyotirvid-
uttararumena lipikrtah Amaddvddamadhye Sddiyama-
dhye 1 paropakdrdrlham Mill
653— MS. Walker 168*
Smrtikaumudi, 17th cent. (ff. 1, 2 by a later hand).
Contents: see Eggeling, India Office catal ., p. 524;
Mitra, Bikaner catal., p. 466 ; Burnell, Tanjore catal.,
p. 133. For Madanapfda’s date see Bhandarkar,
Report, 1883, 1884, p.47 ; Roth, Ind. Stud., XIV, 398;
Eggeling, p. 414 (about a. d. 1375).
The text is bounded on either side by two black
lines.
On f. io6 v is written : ‘Smriti Kaunudi by Mudanu
Pala, K of Dchli.’ Verses 1—13 are repeated in the
Maharnavanibandha, Stein, Kasmlr catal., p. 349.
Measurement, Sfc.: this is part 1 of MS. Walker 168
(1690).
Former owner:
f. io6 v : vyam 0 srikothd \
vya° soma!a 1
rya° gamgadharasyedam \
654— MS. Wilson 219
S'udradharmatattva, after A. D. 1822.
Contents: Mitra, Bikaner catal., p. 499, says that
this is part of a General Digest, the Dharmatattva-
kamalakara. This part was printed at Bombay in
1880. For the author’s date, a. d. 1611, 1612, see
Eggeling, India Office catal., p. 496; Jolly, Recht und
Sitte, p. 39. -
Measurement of binding : 1 ij-xgf in.
Material: paper water-marked ‘ J. Whatman.’
No. of leaves : i + 105 4- i blank. Arranged like a
European book.
Date: the latest date in the water-mark is 1822.
655— MS. Wilson 169 a
Vyavaharamayukha, A. D. 1814.
Contents: on Nilakantha (a. d. 1640) see Eggeling,
India Office catal., pp. 427 sq.; V. N. Mandlik,
Vyavaharamayukha, p. lxxiv, who has translated this
section; Jolly, Recht und Sitte, p. 39; Aufrecht,
Leipzig catal., pp. 159, 160.
Measurement of binding : 13^ X gf in.
Material: yellow country paper.
No. of leaves : ii + 76 + ii blank. Originally paged
in two parts, 1-68 and 1—80. Arranged like a European
book.
Date: f. 35: sakabdd 1736 (= a. d. 1814) l 9 1 18 1
656— MS. Wilson 208
Vyavaharamayukha, after A. D. 1823.
Measurement of binding: 11J x 9^ in.
Material: paper water-marked ‘ J. Whatman.’
No. of leaves : i + 48 + i blank.
Date: the latest date in the water-mark is 1823.
Scribe: by the same hand as 858.
657— MS. Wilson 169 b
S'raddhamayukha, A. D. 1814.
Measurement, fyc. : this is part 2 of the MS. described
under 656.
Date : by the same hand as 665.
658— MS. Wilson 207
Samskarabhaskara, after A. D. 1820.
Contents: see Eggeling, India Office catal., p. 433.
The date of composition must be about a. d. 1660.
Measurement of binding : 1 1 j X 9^ in.
Material: paper water-marked ‘ J. Whatman.’
No. of leaves: ii+51+ii blank. Arranged like a
European book.
Date: the latest date in the water-mark is 1820.
Scribe: see 650.
659— MS. Wilson 214
Karmavipaka, A. D. 1815.
Contents: see Eggeling, India Office catal., p. 575,
cf- p- 433- -
Measurement of binding : 12^ x gl in.
No. of leaves: i +116 4-ii blank. The original
foliation has 118 ff., as ff. 50, 51 are counted as four
(50-51, 52-53). Arranged like a European book.
Date: f. n6 v : samvat 1871 ( = a. d. 1815)1
660— MS. Wilson 29 a
PrayaScittaviveka, A. D. 1819.
Contents: S'ulapani’s date is doubtful. Mitra,
Notices, III, 104 (cf. Haraprasada, Notices, I, pt. iii,
p. x), gives him as a contemporary of Laksmanasena
of Bengal (in the colophons of the MSS. he is some¬
times called Sahudlpala, Sahudi = Sahuria in Bengal)
about a. d. 1120, or 1180 if Bhandarkar is right, but
see Kielhorn, J. R. A. S ., 1906, p. 1010. He is cited by
Raghunandana (about a. d. 1550), but Jolly, Recht und
Sitte, p. 33, thinks he can hardly have lived before Jlmu-
APPENDIX TO VOL. I (652-G69)
83
ivahana (about a. d. 1500, ibid., p. 37), who is always
lentioned at the head of Bengal jurists. Eggeling,
ndia Office catal., p. 460, even says that he quotes
Imutavahana, but this must be simply an oversight.
Jut Jimutavahana cannot be dated in a. d. 1500, see
in 714 , so that the traditional date may be correct.
For this work cf. Eggeling, p. 553 ; Mitra, Notices ,
236.
In the centre of each page is a blank square, with
1 small hole in the middle. Ff. 1-6 contain an index.
Measurement of binding: 19I X 4j in.
Material: yellow country paper.
No. of leaves : ii + 203 + iii blank. In the original
foliation there are (6 + 170+1 blank) + (8 + 18) leaves
in the two parts.
Bate: f. I76 v : sake somayugatricandraganite pansi-
yasukle 2 site I Cf. 671.
661— MS. Wilson 24b
Tattvarthakaumudl, after A. D. 1810.
Contents : see Mitra, Notices , II, 63 ; Eggeling,
India Office catal., p. 554.
Measurement, fyc. : this is part 2 of the MS. described
under 643.
662— MS. Wilson 20 b
Tithidvaitaprakarana, A. D. 1800.
Contents : the title should be Tithidvaitaprakarana.
For a list of the scholiast’s works (17th cent.?) see
Aufrecht, Catalogus Catalogorum, p. 670.
In the centre of each page is a blank square with
a hole in the middle.
Measurement, Sfc.: this is part 2 of the MS. described
under 660.
Bate:
(1) f. 185: sakabdah 1721 (« a. d. 1799) l
(2) f. 203 : sakabdah 1722 ( = a. d. 1800) l
663, 664— MSS. Walker 176, 177
Vrataprakasa or Vrataraja, 19th cent.?
Contents: 177, ff. 231 sq. contains a large number
of vratas for special occasions. It ends, on f. 316: iti
Brahmamdapurane laksapujavratodyapanam sampurnam\
The text is bounded on either side by two red lines.
Ff. 486, 490 of the original foliation are reversed.
Lacunae are frequently marked.
Measurement of binding: ii|- x 6-| in.
No. of leaves: 176 = ii + 285 + ii blank ; 177 = ii +
316 + ii blank. The original foliation makes 602 leaves
numbered consecutively, but there is no f. 487.
665-667— MSS. Wilson 216-217
Vratakalpadruma, A. D. 1816.
Contents : see Mitra, Notices, IV, 276-283, Bikaner
catal., p. 396.
There are very many lacunae in the text. Wilson
has added remarks on the margins.
Measurement of binding : 11 j X 9^ in. approximately
for each volume.
Material; paper water-marked ‘ S. & C. Wise.’
No. of leaves : 216 = iii + 177 + iii blank ; 216 = ii +
206+ ii blank; 217 = ii +204 +ii blank. Originally the
last two volumes were foliated consecutively, making
410 leaves. Arranged like a European book.
Bate: 217, f. 2C>4 V : samvat 1871 ( = a. d. 1815)
margasirsasuklasaptamyam ravivdsare trtiye prahare
gramtha sampurnam \
Scribe: 217, f. 204 v : iha pothi mistaravolisena
{ — Mr. Wilson) sahavake vaste lekhakasamkaralala sa-
kina Vanarasa l
668 — MS. Wilson 2130
Sarasamgraha, after A. D. 1810.
Contents : for the original of this MS. see Eggeling,
India Office catal., p. 535. If this is the work quoted in
Madanaparijata it must be dated before a. d. 1360 at
latest. Quite different is that mentioned by Mitra,
Notices, I, 262, 263, and quoted by Aufrecht, Catalogus
Catalogorum, p. 713.
Measurement, fyc.: this is part 3 of MS. Wilson 213
(1070).
Scribe: all three parts are by one hand.
669— MS. Wilson 204 a
Smrtyarthasagara, A. D. 1741.
Contents: Chalari Nrsimha wrote the work in
a. d. 1682, Aufrecht, Catalogus Catalogorum p. 748.
Madhva’s date is stated to be that of his death,
not his birth, see Bhandarkar, Report, 1882, 1883,
p. 202. But Nrsimha evidently refers to his date of
birth, and this is supported by the epigraphic evidence
in Ep. Ind., VI, 261.
The text is bounded on either side by two black lines.
Measurement of binding : 12^ x 7j in.
No. of leaves: ii + 62+ ii blank. In the original
foliation the two parts have 28 + 34 leaves.
Bate: t. 28 v : sake 1663 ( = a.d. 1741) m samvatsare
kartikakrsnaikadasydm bhanuvasare Kalaghattigojyoti-
syahotribhattatmajena likhitam gramtha samdptim aga-
mat I
Injuries: ff. 23-28 are damaged by water.
m 2
84
CATALOGUE OF SANSKRIT MSS.
670—MS. Wilson 212
Smrtyarthasara, after A. D. 1810.
Contents: Sridhara must be referred to about
a. d. 1150-1200, as he quotes Govindarfija and is
quoted by Hemadri, Jolly, Recht und Sitte, p. 35;
Bhandarkar, Report , 1883,1884, p. 46 ; Eggeling, India
Office catal., pp. 468 sq.; Z.D.M. G., XLVI, 279. Other
MSS. are mentioned by Mitra, Notices , VII, 248, VIII,
t 6 ; Aufrecht, Leipzig ccital., p. 148.
Measurement of binding : 13 x 9! in.
Material: paper water-marked ‘ S. & C. Wise/
No. of leaves : iii + 78 + ii blank. Arranged like a
European book.
Dale: the latest date in the water-mark is 1810.
See also f. 78 : sauramaghasya trayodasadivase fcuja-
vare \
Scribe: f. 78 : likhitah sripitdmbarasarmmand 1
671—MS. Wilson 25b
Ahnikatattva, A. D. 1819.
Contents : printed in Smrtitattva , 1,199-275, Seram-
pore, 1834-1835.
In the centre of each page is a square blank space.
Measurement, fyc.: this is part 2 of the MS. described
under 080.
Date: f. 2i5 v : Sake candrayugdtri (f)-somaganite
(= 1741 = a. d. 1819) 1 Cf. 000.
672—MS. Wilson 34 a
Ahnikatattva, A.D. 1813.
Contents: Raghunandana’s date is fixed by the fact
that he is quoted by Kamalakara (a. d. 1612), men¬
tions in his Jyotistattva the year a.d. 1498, and was
a contemporary of Caitanya (a.d. 1486-1527), Jolly,
Recht und Sitte, p. 38. As he quotes Vacaspati’s
Cintamani, about a.d. 1510 (see on 048), he cannot be
dated much before a. d. 1550, perhaps about a. d. 1525.
According to Haraprasada, Notices, I, pt. iii, p. ix, he
is later than the Ilaribhaktivilasa, a. d. 1562, but this
argument cannot be pressed.
Measurement of binding : i6| x 6 in.
Material: yellow country paper.
No. of leaves: ii + 289 + ii blank. The three parts
in the original foliation have 145 (+1 blank)4-102
(really 103, as f. 74 is repeated, + 1 blank)+ 39 leaves.
Date: f. 145: sakabddh ( = a.d. 1813)1
Scribe: probably as in 704.
673— MS. Wilson 163*
Ekada&itattva, after A. D. 1810.
Contents: printed in Smrtitattva, II, 1-58, and
with Radhamohana Gosvamin’s commentary, Calcutta,
1886. Ff. 32-34 have been supplied by a later hand,
probably that of 080, and the colophon on f. 92 is in
another hand.
Measurement of binding : 157 x 5^ in.
Material: yellow country paper.
No. of leaves : ii-f 179+ii blank. The three parts
in the original foliation have 82 (really 92, ff. 50-59
being repeated) +10 + 77 leaves.
Scribe: probably as in 093.
674— MS. Wilson 30 a
Krtyatattva, before A.D. 1790.
Contents: printed in Smrtitattva, II, 237 sq.
Measurement of binding : 18 x 4^ in.
No. of leaves: ii+ 102 + ii blank. The two parts in
the original foliation have 70 + 32 leaves.
675—MS. Wilson 33 c
Grahaytynatattva, A.D. 1832.
Contents: see Eggeling, India Office catal., p. 421;
printed in Smrtitattva, I, 540 sq.
In the centre of each page is the usual blank square.
Measurement , fyc.: this is part 3 of the MS. described
under 893.
Date : f. 129: sana 1239 sala° Sakabdah 1754 (= a. d.
1832)1 Cf. 890.
Scribe: f. 129: likhitam sfisisurdmadevasarmmana I
Cf. 702.
676—MS. Wilson 162^
Jalasayotsargatattva, A.D. 1830.
Contents : printed in Smrtitattva, II, 289-297.
In the centre of each page is a blank square with
a lozenge-shaped hole in the middle.
Measurement, Sfc.: this is part 4 of the MS. described
under 700.
Date: f. ii 6 v : sana 1237 sala° sakabdafy 1752
(= a. d. 1830) 1
APPENDIX TO VOL. I (670-684)
85
677— MS. Wilson 23*>
Jyotistattva, after A. D. 1810.
Contents : printed in Smrtitattva, I, 329-425 ; see
Eggeling, India Office catal., p. 420.
In the centre of each page there is a blank square.
Measurement, fyc.: this is part 2 of the MS. described
under 000.
Scribe : perhaps Devanatha, scribe of 671.
678— MS. Wilson 25°
Jyotistattva, after A. D. 1810.
Measurement, fyc.: this is part 3 of the MS. described
under 080.
Scribe: perhaps by the same hand as 680.
679— MS. Wilson 85 a
Tithitattva, A. D. 1825.
Contents: printed in Smrtitattva, I, 1-121. Cf.
Garbe, Tubingen catal., p. 62. Based, according to
Mitra, Notices, IX, 237, on Sulapani’s Tithiviveka.
It includes the description of chess.
Edited, with a commentary, by Kasirama Vacaspati,
Calcutta, 1871. See Eggeling, India Office catal., p.423.
In the centre of each page is usually a blank square.
Measurement of binding : i6| X 5! in.
Material : yellow country paper.
No. of leaves : ii + 288 + ii blank. The two parts
in the original foliation have 142 4-146 leaves.
Bate: f/i42 v : dhatuveddmbhudh.au candre sakabde
( = a. d. 1825) l
Scribe : f. I42 v : kriharo dvijah 1 Cf. 086.
680— MS. Wilson 25 a
Tithitattva, after A. D. 1820.
Contents : in the centre of each page is a square
blank space. — _
Measurement of binding: i9jX4|-in.
Material ; brown or yellow paper.
No. of leaves : ii+325+ ii blank. The three parts
in the original foliation have 124 + 91 + no leaves.
Scribe : f. 124: lipir iyarn krivanaramadevakarmma-
nah \
681— MS. Wilson 86 a
Tithitattva, A. D. 1812.
Measurement of binding : i6\x 5! in.
Material : yellow country paper.
No. of leaves : ii + 311 + ii blank. In the original
foliation the two parts have 170+140 leaves (really
141, as f. 54 is repeated).
Bate: f. 170: sakabddhiJ34( = a. i>. 1812) \srdvanasya
site pakse pancamyam bhaumyavasare I
Scribe: f. 170: vyalekhi krijaganndthakarmmana I
682— MS. Wilson 31 a
Tithitattvatika, 10th cent. P
Contents: Kasirama is ascribed to the 18th cent,
by Haraprasada, Notices, I, pt. iii, p. xx, but probably
belongs to the 17th cent. A MS. of 1671 (a. d. ? or
samvat) is mentioned by Eggeling, India Office catal.,
p. 421.
In the centre of each page is a blank square, with
a small circle to represent a hole in the middle.
Measurement of binding : i8j x 5^ in.
Material: yellow country paper.
No. of leaves : ii +201+ii blank. The two parts
in the original foliation have no (really iii, f. 102
being repeated)+ 90 leaves.
Scribe : by the same hand as 004.
683— MS. Wilson 33d
Tirthayatratattva, A. D. 1821.
Contents : this is probably an additional treatise, or
practical manual written after the completion of the
Digest, which deals with the matter according to the
recognized authorities, Eggeling, India Office catal.,
p. 421.
In the centre of each page is the usual blank space
with a hole in the middle.
Measurement, fyc.: this is part 4 of the MS. described
under 603.
Scribe: written by the same hand as 080 and 003.
684— MS. Wilson 200 a
Dayatattva, after A. D. 1810.
Contents: printed at Calcutta in 1828. Cf. Eggeling,
India Office catal., p. 422.
Measurement of binding: i3f x 6f in.
No. of leaves: ii + 142 + ii blank. This part has 32
leaves, the foliation of part 2 is confused.
Scribe: both parts are apparently by one hand.
86
CATALOGUE OF
685— MS. Wilson 34c
Dayatattva, A. D. 1813.
Measurement, 8fc.: this is part 3 of the MS. described
under 072.
Bate : f. 289^: Sakabdah 1735 ( = a. d. 1813) sukra-
sya site pakse divase auru (?) vasare \
Scribe: f. 289 v : vyalekhi srijaganndthasarmmand
dvijasunund I
686 — MS. Wilson 33^
Dayatattva, A. D. 1825.
Contents: in the centre of each page is the usual
blank square. ——
Measurement, fyc.: this is part 2 of the MS. described
under 003.
Bate: f. 123: samudravedambhudhicandrasdke (= a.d.
1825, but samudra may be 4, and the date is then
1822) I sukrasya sadvimsatime dine ) pi I
Scribe: f. 123: Bdyasya tattvam vilikhed Bhard-
khyah \ Cf. 070.
687— MS. Wilson 30^
Divyatattva, A. D. 1700.
Contents: printed in Smrtitattva, II, 327 sq. Cf.
Vacaspati translated by Rocca, I Giudizl di Dio,
Livorno, 1904.
In the centre of each page is a blank square.
Measurement, Sfc.: this is part 2 of the MS. described
under 074.
Bate : this MS., written in saka 1718 (=a.d. 1796),
must be a little more recent than 074.
688 — MS. Wilson 102*
Durgotsavatattva, A. D. 1700-1800.
Contents: printed in Smrtitattva, I, 40—66.
Measurement, fyc.: this is part 4 of the MS. described
under 707.
Scribe: f. i$6 y : sriramatanudevasarmmanah sak$a-
ram idarn pustakan ca \ Cf. 008, 707.
689— MS. Wilson 33 *
Puru^ottamatirthaprayogatattva, A.D. 1821.
Contents: see Smrtitattva , II, 319—325.
There is a blank space in the centre as in 083.
Measurement, fyc.: this is part 6 of the MS. described
under 003.
Bate: f. 182 V : sakabdah 1743 ( = a. d. 1821)1
Scribe: f. i 82 v : srirdmatanuvidyavagisasya pusta-
kam idarn \ Probably both scribe and owner. Cf. 088.
SANSKRIT MSS.
690— MS. Wilson 23a
Prayaicittatattva, A. D. 1832.
Contents: printed in Smrtitattva, I, 277—327. Cf.
Eggeling, India Office catal., p. 420.
Measurement of binding: 19^ x 5 in.
Material: country paper, usually yellow.
No. of leaves: ii + 269 + ii blank. The four parts in
the original foliation have 80+109 + 41+39 leaves.
Bate: f. 8o v : sakabdah 1754 l Sana 1239 l This
fixes the year as a. d. 1832. Cf. 075.
Scribe : f. 8o v : sricandrasekharadevasarmmana pus-
takam idarn likhite \
691— MS. Wilson 34b
Prayaicittatattva, A.D. 1812.
Measurement, fyc.: this is part 2 of the MS. described
under 072.
Bate: f. 249 v : bake candrubdhijalane vede ca ganite
tathd l samdptir abhavad grant hah pradhne (probably =
bradhne) ca divase 2 site 11 Cf. 704, where also the
date seems to be sake 1734 ( = a.d. 1812).
Scribe : as in 704.
692— MS. Wilson 203 a
Prayaicittatattva, A.D. 1813.
Measurement of binding : 117 * 97 in.
Material: the paper is water-marked ‘ Budgen &
Wilmott/
No. of leaves : i + 114 + i blank. The two parts have
60 + 54 leaves. Arranged like a European book.
Bate: the date of part 2 is given on f. ii4 v , and
applies equally to part 1 : Sakabdah 1735 ( = a.d. 1813)
jai?thasukladvddasydm \
Scribe - f. ii4 v : sripltdmbarabhatldcdryena likhito
’yarn Dvaitanirnayah \
693—MS. Wilson 33^
Malamasatattva or Malimlucatattva, A. D. 1821.
Contents: printed in Smrtitattva, I, 427—492, and
separately, Calcutta, 1887, by Krsnanatha Nyayapanca-
nana.
In the centre of each page is the usual blank square.
Ff. 95-97 seem to have been recently supplied by the
same hand as 075 , 702.
Measurement of binding: 17 x 5-| in.
Material: yellow country paper.
No. of leaves: ii + 182+ ii blank. In the original
foliation the six parts have 95 (really 97, ff. 16, 49
being repeated) + 26 + 6 + 19+15 + 19 leaves.
APPENDIX TO VOL. I (685-702)
87
094— MS. Wilson 31b
Malamasatattvatika, 19th cent. P
Contents ; see Eggeling, India Office catal. , p. 421;
Mitra, Notices , III, 103.
There is a blank space in the centre as in 682.
Measurement, fyc. : this is part 2 of the MS. described
under 082.
695— MS. Wilson 162°
Vastuyagatattva, A.D. 1734.
Contents : printed in Smrtitattva, II, 229-235.
F. ioi v contains an index. In the centre of each
page is a blank square.
Measurement, Sfc. : this is part 3 of the MS. described
under 700.
Date : f. 101: sadartharasakosake ( = a. d. 1734) I
Scribe: f. 101 : vyalekhi pustakah cedam sriramata-
nuna I
696— MS. Wilson 23o
Vivahatattva, A.D. 1826.
Contents : printed in Smrtitattva , II, 59-83.
Measurement, 8fc. : this is part 3 of the MS. described
under 600.
Date : f. 230 v : bubham astu sakabdafy 1748 ( = a. d.
1826)1
697— MS. Wilson 162 °
Yajurvedivrsotsargatattva, A. D. 1705.
Contents : printed in Smrtitattva , II, 363—367.
In the centre of each page is a blank square.
Measurement, fyc. : this is part 3 of the MS. described
under 707 .
Date : f. 112 V : lipir esa bhadrasya sodasadevasiya 1
sakabdah 1717 ( = a. d. 1795) I
Scribe : f. 112 V : srijaganndthadevasarmmana likhi -
tarn pustakam idarn \
698 — MS. Wilson 162b
SamagavTSotsargatattva, A. D. 1795.
Contents: printed in Smrtitattva , II, 299—317.
In the centre of each page is a blank square with
a hole in the middle.
Measurement , Sfc. : this is part 2 of the MS. described
Under 707 .
Scribe : as in 088 , 707 .
699— MS. Wilson 23d
Vyavaharatattva, A.D. 1824.
Contents : printed in Smrtitattva , II, 111-130.
Measurement , fyc. : this is part 4 of the MS. described
under 000.
Date : f. 269V: kakabdah 1746 ( = a. d. 1824) I
700— MS. Wilson 152 a
Vratatattva, A.D. 1827.
Contents : printed in Smrtitattva , II, 85—90.
Measurement of binding: i6-| X 4j in.
Material : country paper, of a grey tinge.
No. of leaves : ii + 116 + ii blank. The four parts in
the original foliation have 10 + 79 (really 80, as two ff.,
numbered 77 have been supplied for the original f. 77)
+ 11 + 15 leaves.
Date: f. io v : sakabdah 1749 ( = a.d. 1827)1
701— MS. Wilson 152 b
S'uddhitattva, A.D. 1005.
Contents : printed in Smrtitattva, II, 131-228 ; and
with Kasirama’s commentary, Calcutta, 1884.
In the centre of each page is an oblong blank space.
F. 77 (old foliation) is lost, and has been replaced by
the two leaves numbered 87, 88 in the new foliation.
Measurement, Sfc. : this is part 2 of the MS. described
under 700.
Date : f. 90 v : sake saptastavanendumite pakse site
tithau (?) sastyam l (illegible) gurau dine l sakabdah.
I587 ( = A.D. 1665) I
Scribe: f. 90 v : sriyadavendrena lilikhe \
Character: the diacritical mark of r is usually omitted.
702— MS. Wilson 33 e
S'udrakrtyavicaratattva, A.D. 1821.
Contents: printed in Smrtitattva, II, 361, 362.
This, like the other pieces, differs more or less from
the text in the edition.
Measurement, Sfc. : this is part 5 of the MS. described
under 093.
Scribe: f. 163: svaksaram idarn srisiSurdmadeva-
sarmmanam iti \ Cf. 075.
88
CATALOGUE OF
703— MS. Wilson 163c
Chandoga6raddhatattva, about A. D. 1790.
Contents: printed in Smrtitattva, I, 123-198.
Measurement, 8fC.: this is part 3 of the MS. described
under 073.
704— MS - Wilson 36 b
Chandogasraddhatattva, A. D. 1812.
Measurement, 8fc.: this is part 2 of the MS. described
under 081.
Date: f. 31 v : sake candrabdhtjalane vede ca ganite
tatha I vyalekhi S'raddhatattvam ca srlyuktadvijasununa 11
bahulasya site pakse divase candravdsare l This ap¬
parently means sake 1734 ( = A - D< I ^ 12 )* Cf. 091.
Scribe : as in 081, 085, 001, 714, and probably 872.
705— MS. Wilson 35 b
Chandoga6raddhatattvatika, A. D. 1812.
Contents : in the centre of each page is the usual
blank square, with a circle in the middle to represent
a hole. —
Measurement, fyc.: this is part 2 of the MS. described
under 070.
Date: f. 288 : sakdbdah 1734( = a. d. 1812) 1 magha-
masiyacaturthadivasiyeyam lipih \
706— MS. Wilson 153 b
Yajurvedifiraddhatattva, after A. D. 1816.
Contents: printed in Smrtitattva, II, 270-281.
Measurement, fyc.: this is part 2 of the MS. described
under 073.
Scribe: f. 102: h'imadanamohanadevasarmmanafy
svaksaram idarn pustakan ca \ Probably scribe and
owner.
707— MS. Wilson 162°
Samskaratattva, A. D. 1780-1800.
Contents: printed in Smrtitattva , I, 493-543.
Measurement of binding : 14^X4^ in.
Material: yellow and grey country paper.
No. of leaves : ii + 136 (really 137, as f. 67 is double)
+ ii blank. The four parts in the original foliation
have 68 + 33+12 + 24 leaves.
Scribe : f. 6j y : srlramatanudevasarmmanah saksaram
idarn pustakan ca \ Cf. 888, 898.
708—MS. Wilson 176
Gangavakyavali, 10th cent.?
Contents: Yidyapati’s <late is apparently about
a. d. 1470. An attempt has been made by Bhan-
SANSKRIT MSS.
darkar, Report, 1883, 1884, p. 52, and accepted by
Jolly, Recht und Sitte, p. 36, to date him in a. d. 1230,
taking his patron Narasimha as an ancestor of the
Harisimha, who founded a new dynasty (but cf.
J.R.A.S., 1907, p. 1084) in Nepal in a. d. 1324.
But this breaks down utterly if we consider the real
lineage of the Mithila dynasty found in Bhandarkar’s
own MS. (cf. p. 352), Ind. Antiq., XIY, 187, 196;
Eggeling, India Office catal., pp. 875, 876. The
present w'ork was written under Yisvasadevi, a. d.
1458-1470. The exact dates are doubtful, Duff,
Chronol. of India, p. 237.
No. 718 was written probably about a. d. 1500 : the
genealogy is (cf. Bendall, Brit. Mus. catal., p. 75;
J. R. A. S., 1898, p. 232):
Bhavesvara, second king
I
Harasimha, prince
Narasimha or Darpanarayana (reigned a.d. 1470, 1471)
Candrasimha, prince, married Lakhimii Devi.
That Yidyapati is identical with the poet, as Grier¬
son, Lid. Ant., 1 . c., supposes, is doubted by Eggeling,
l. c. For another MS. see Eggeling, p. 594.
Measurement of binding : 16-7 x 4^ in.
Material: yellow country paper.
No. of leaves : ii + 111 + ii blank.
709— MS. Mill 74 a
PrayaScittapaddhati, A.D. 1009.
Contents: the note on f. i v , Hemadri 0 pr°, is ex¬
plained by the fact that at the foot of f. i v are
the words : at ha Hemadriprayogasamkalpah l which
apparently is a citation of Hemadri. Immediately
after this ten leaves, ff. 2—10, are missing. Then the
work continues : ajighra kalasam iti kalasam sthdpayet I
mahl dyaur iti jalenapuryu l gamdhadvdrdm iti gamdham
ksipet 1 yd osadhir iti sarvausadhih osadhayah sam iti
yavan l kdmddit kamdad iti durva 1 asvaty eva iti pamca
pallavan 1 &c.
If Kamadeva cites Hemadri he cannot well be the
Kamadeva, father of Hemadri.
The text is bounded on either side by two red lines.
Addenda in a later hand on ff. 2 V , 3.
• Measurement, 8fc.: this is part 1 of MS. Mill 74 (1013).
Date: f. 8: sake 1591 ( = a. d. 1669) caitravadi 10
ravau 1
Scribe : f. 8 : likhitam upadhydyamddhavoji svartham
paropakarartham 1
APPENDIX TO VOL. I (703-715)
89
710— ms. Wilson 527
S'raddhacintamani, A.D. 1784.
Contents : Aufrecht, Catalogus Catalogorum, II, T59,
listinguishes the S'raddhacintamani as here, from the
Prayogapaddhati Subodhini, an explanation of this, in
Eggeling, India Office catal ., p. 559; Stein, Kasrmr
catal., p. 105 (ff. 72, S'raddhacintdmanau Prayoga-
oaddhatib Subodhini ). This is wrong: all three are
identical. But the India Office MS. contains the
beginning (20 leaves), which is missing in this MS.,
f. 1 answering to f. 21 of the India Office MS. and
the end to f. 59 v , &c. ( Durvapujaprayoga , f. 8o v , &c.).
This MS. is written by two different hands: (1)
ff. i~37 v , (2) ff. 38 v —87. In the latter part the text
is bounded on either side by two double red fines.
The whole ends with the verse : (beginning deleted,
perhaps Subodhiniyam ) Visramasuklasya tanayena hi 1
Stvaramena racita paddhatir vidusam mude ll
Measurement of binding : iof X 5^ in.
No. of leaves: ii + 87+ ii blank. In the original
foliation 37 + 50.
Bate: f. 87: samvat 1841 sake 1706 ( = a. d. 1784)
kdtikakrsnapunyam \
Scribe : name deleted.
711— MS. Wilson 480 b
S'raddha, 10th cent.P
Contents: on f. 1 is written: atrya
gavisfhira
paurvatithiya
S'amkhdyanasdkhd I
Evidently this tract claims to follow the Sahkhayana
school.
The text is bounded on either side by two black fines.
Measurement, fyc. : this is part 2 of the MS. described
under 80.
712— MS. Mill 104
S'raddha, 18th cent. ?
Contents: the text is occasionally bounded on either
side by two double red fines.
Measurement of binding : 7-i- x 4^ in.
No. of leaves: ii + 43 + ii blank.
713 —MS. Wilson 220
Mitrodaya, after A. D. 1810.
Contents : West and Biihler, Digest , 3 I, 22, identify
Virasimha with Birsinh Deo of Orcha, who murdered
Abul Fazl, minister of Akbar, a.d. 1602. He lived
also under Shah Jahan (1628-1658), Jolly, Recht und
Sitte, p. 39, Z.D.M.G. , XLVI, 269-271; Eggeling,
India Office catal., pp. 371 sq., 438 sq.
Edited by Jlvananda Vidyasagara, Calcutta, 1875.
Measurement of binding: 12 j X io|- in.
Material: paper water-marked ‘ S. & C. Wise/
No. of leaves : iii + 218 + iii blank. Arranged like a
European book.
Date: the latest date in the water-mark is 1810.
714— MS. Wilson 154
Dayabhaga, A.D. 1813.
Contents: Jimutavahana’s date is very doubtful.
His scholiasts assert that he refers to Vacaspatimisra
(about a.d. 1510, see on 048), and R. Sarvadhikari,
Tagore Law Led., 1880, p. 402, endeavours to prove
that he refers to him as Misra, a view accepted by
Eggeling, India Office catal., p. 460. This is, however,
impossible, because Mitra, Notices, II, 297, mentions
a MS. of kaka 1417 (=a. d. 1495), which, not being
apparently an autograph, takes us back to about a. d.
1460 at latest for the composition of this work, and
Misra’s work falls about fifty years later. This Misra
cannot therefore be meant. Again, he is antecedent
to Raghunandana (a. d. i 525, see on 072), and—as
he is named at the head of the Bengali school—
perhaps to Sulapani (12th cent.?, see on 600). This
fits in well with the fact that he quotes only old
authors, such as Bhoja, Visvarupa (nth cent.), cf.
Jolly, Recht und Sitte, p. 37, Z.D.M.G., XLVI, 278,
XLVII, 617.
Edited, with seven commentaries, by Bharatacandra
S'iromani for Prasanna Kumar Tagore, Calcutta, 1863-
1866. ’ -
Measurement of binding: 16 x 5J in.
Material: yellow country paper.
No. of leaves : ii + 100 +ii blank. The original folia¬
tion makes 99 leaves.
Date: f. 100: sakabdah 1735 ( = a. d. 1813) vaisa-
khasya site pakse caturthlsamjnaya tithau \ lipir esd
vaisakhasya sodahadivasiyeti \
Scribe: f. ioo v : vyalekhi Jaganndthakarmmana \ Cf.
704.
715 —MS. Wilson 200 b
Dayabhaga, after A.D. 1810.
Contents: ff. 55-104, 127—142 are on yellow paper.
Lacunae are very frequent.
Measurement, l$c.: this is part 2 of the MS. described
under 084.
BODL. SANS. CATAL. APP.
N
90
CATALOGUE OF SANSKRIT MSS.
7X6—MS- Wilson 24 c
Putrakramadipika, A. D. 1822.
Contents: in the centre of each page is an oblong
blank space.
Measurement, Sfc.: this is part 3 of the MS. described
under 643.
Date: f. IJ9 V : sakdbdah 1744 ( = a.d. 1822) I
Scribe : f. j 79 v : srUrirdmasarmmanah \
717— MS. Wilson 204 b
Putrikaranamimamsa or Dattakamlmamsa,
A.D. 1826.
Contents: see Eggeling, India Office catal., p. 467.
The author composed the Kesavavaijayanti in a. d.
1623, ibid., p. 393. Often printed, e. g. at Benares in
1874; translated by Sutherland, 1814. Cf. Jolly,
Recht und Sitte, p. 38.
Measurement, Sfc.: this is part 2 of the MS. described
under 660.
Date: f. 62 : samvat 1882 sa° 1736 ( = a.d. 1826 and
1814!) 1
718— MS. Wilson 163 ft
Vivadacandra, 19th cent. ?
Contents : according to Eggeling, India Office catal.,
p. 454, Lakhima (i. e. LaksmI) was the author. Cf.
Bhandarkar, Report, 1883, 1884, p. 48; Sarvadhikari,
Tagore Law Led., p. 398. The reference is not, as
Aufrecht supposed, to Ilarisimhadeva of Nepal and
Tirhut, of whom there are records in a.d. 1314 and
1324, Bendall, Catal. Buddh. MSS., p. xv. Duff,
Chronol. of India, p. 216, but to a prince of the later
dynasty of Kamesa, of which an inaccurate list is given
in Duff, Chronol. of India, p. 305, and for which see
on 648 and 708.
Ff. 79, 80 contain indices.
Measurement of binding: 15^ X in.
No. of leaves: ii+251 4-ii blank. In the original
foliation the five parts have 80 + 864-49 (really 50, as
f. 30 is repeated) +1+34 leaves.
719-721—MS. Wilson 222-224
Vivadabhahgarnava, after A. D. 1826.
Contents: the work was compiled for Sir William
Jones, see Wilson, Mackenzie Coll., p. 108. Cole-
brooke’s translation in four volumes appeared in 1798
(3rd ed. in 1864).
Some calculations and a few lines of writing on
ff. 243, 244 of 224. .. -
Measurement of binding: 12j X 8 in.
Material: European paper, water-marked ‘ J. What¬
man.*
No. of leaves :
222 = iii + 268 + ix blank. In the original foliation
288, but there are no ff. 77-86, 180-189.
223 = iii + 182 + iii blank. In the original foliation
192, but there are no ff. 137-146.
224 = i +244+ i blank. In the original foliation
76 + 175 + ii blank, but a blank leaf is inserted after f. 1
of the second part, and there are no ff. 7 2-81. Leaves
arranged as in a European book.
Date : the paper is water-marked 1826.
722— MS. MiH 77 a
Gayatribhasya, 10th cent. P
Measurement of binding: io|- x in.
No. of leaves: ii + 148 +ii blank. The three parts
in the original foliation have 26 + 47 (really 48, f. 33
being repeated) + 74 leaves.
723— MS. Mill 102
Rudrajapa, A.D. 1744.
Contents : on f. iii is written by Dr. Mill: ‘ Another
Rudra-japa [beside no. iii of the Yajur-veda] following
another edition of the Vajasanaiya Sanhita in the
passages taken from it, and also borrowing hymns
from other Yedic sources to make up the collection,
mostly from the Rig-veda, and indeed the passages
resembling those of the V. S. S., I am assured by Go-
vinda Sastrin, belong to thisVeda. Complete.* Govinda
was correct. See Aufrecht, Leipzig catal., pp. 3, 7.
The text is bounded on either side by red lines,
usually two. — —. ■
Measurement of binding : 8|- x 5-| in.
No. of leaves : ii + 27 + ii blank.
Date: f. 27: samvat 1800 (=a. d. 1744) varse
caitravadi 11 1 varabhome I
Scribe: f. 27 : likhitam bhatadevararna Ramacamdra-
pathanartham l This division is perhaps better than
taking Devaramaramacandra as one name.
724— MS. MiU 76
Rudrajapya, A.D. 1687.
Contents: all of Uvata’s commentary is now known.
For his date see on MS. Sansk. d. 2 (030).
The text is bounded on either side by three dark red
lines. —-
Measurement of binding: io| x 5! in.
No. of leaves: ii + 100 + ii blank. The original folia¬
tion makes 70 + 31 (really 30, f. 1 being lost).
Date: that of part 2 is given on f. 100: sam 1643
(=a. d. 1587) bha° kr° 12 some \
Scribe : the hand of part 1 bears some resemblance,
especially in its size, to that of MS. Wilson 450 (864(4)).
APPENDIX TO VOL. I (716-734)
91
725—MS. Wilson 426e
Oevlsukta, Ratrlsukta, and Laksmisukta, 19th cent. ?
Contents: besides the three hymns, Rg-veda X, 125,
127, and the Khila after V, 87, the MS. gives the
suitable viniyoga and dhyana. Cf. Aufrecht, Leipzig
catal., pp. 2, 3; and for the Khila, Scheftelowitz, Lie
Apokryphen des Rgveda , pp. 72 sq.
Measurement, 8fc .; this is part 4 of the MS. described
under 661 .
Scribe: possibly identical with that of 737 , but
written earlier, 1810-1820.
726—MS. Wilson 304b
Saura, A. D. 1788.
Contents : the accents are added as usual in red ink.
The text is bounded on either side by two double
red lines. ■
Measurement, 8fc.: this is part 2 of MS. Wilson 394
( 1032 ).
Date : f. 67 : miti pausasuddha 5 pamcami ravivara
samvat 1844 ( = a.d. 1788) cave calisa \
727— MS. Wilson 63ls
Adityahrdayastotramantra, 19th cent. P
Contents: printed in Brhatstotraratnakara, pp. 141 sq.
Verse 154 is merely yad aksarapadabhrastam, &c. Cf.
Aufrecht, Leipzig catal., pp. 71, 72 ; Bendall, Brit.
Mus. catal., p. 47. -
Measurement, fyc.: this is part 5 of the MS. described
under 667 .
728— MS. Wilson 6311
DattatreyastottaraSatanamastotra, 19 th cent. P
Measurement, fyc.: this is part 8 (ff. 6 v -8) of the
MS. described under 667 .
729— MS. Walker 129 e
Bhairavastotra (taken from Rudrayamala),
18th cent. P
Contents: the text is bounded on either side by
three red lines. In the centre of each page is the
usual Jaina figure, partially filled up by a red spot.
Red spots are placed in either margin.
This is identical with the Rudrayamale Visvasarod-
dhare Damarutantre Apaduddharakabatukabhairava-
stotrarajah (71 verses) in Aufrecht, Flor. catal., p. 124,
Leipzig catal., pp. 391, 392; Weber, Catal., I, 360
(67 verses). *____
Measurement, fyc.: this is part 7 of the MS. described
under 08 .
Character: Jaina Devanagari.
730— MS. Walker 120*
Ganapatistotrani, &c., 18th cent. P
Contents: e, Ganesabhujanga, is attributed to Saii-
karacarya, Burnell, Tanjore catal., p. 197^. 243
is really a part of this MS., and has been separated
merely by a mistake. The leaves are numbered 1—3,
1—9. Written in the same style as 243, but in ff. 1-9
five red spots in the centre are substituted for the
cakra, and the yellow line in the margin is omitted.
For the beginning of e corrected, see Aufrecht,
Flor. catal., p. 73. ____
Measurement, fyc.: this is part 9 of the MS. described
under 08 .
Scribe : as in 78 .
Character: Jaina Devanagari.
731— MS. Mill 112s
Ramagita, 18 th cent. P
Contents: this forms the fifth chapter of the Uttara-
khanda of the Adhyatmaramayana, and is printed in
Brhatstotraratnakara, p. 231. Cf. Aufrecht, Leipzig
catal., pp. 61, 62. The commentary is that of Mahi-
dhara, written a. d. 1603.
Measurement, fyc.: this is part 4 of the MS. described
under 22.
732— MS. Mill 112b
Ramamantrapatala, 18th cent. P
Contents: this is really a Tantra work, Aufrecht,
Flor. catal., p. 144. ________
Measurement, fyc.: this is part 5 of the MS. described
under 22.
733— MS. Mill 112 i
S'riramapaddhati, 18th cent. P
Contents : to Ramanuja is also ascribed a Ramagita-
stotra, Aufrecht, Leipzig catal., p. 44.
Measurement, fyc.: this is part 6 of the MS. described
under 22.
734— MS. Walker 211
Mantrarahasyaprakafoka, 17th cent. P
Contents: cf. Mitra, Notices, IV, 104. About 200
verses are dealt with. The title in Eggeling, India
Office catal., p. 588, is Mantrabhagavatavyakhya.
The text is bounded on either side by three broad
red lines. _
Measurement of binding : io|x 7j in.
No. of leaves : ii + 80 + ii blank.
N 2
92
CATALOGUE OF SANSKRIT MSS.
735_MS. Wilson 317
Urdhvamnayasamhita, after A. D. 1810.
Contents: ascribed to Narada according to Mitra,
Notices, I, 128. —
Measurement of binding: u|X4|in.
Material: yellow country paper.
No. of leaves : i + 31 + i blank. The original foliation
makes 30 leaves, but f. 26 is double.
736— MS. Wilson 337 b
Narayanagita, 19th cent. P
Contents: no other MS. seems to be known. On
this Ramananda see H. H. Wilson, Works, 1,46. On
f. 20 v is written by Wilson : ‘ Narayana Gita, ex variis
Puranis desumpta, Sanscritice composita a Ramaprasa-
dha ex instruction Ramanandi illius sectae Pontificis
3th.’ This disposes of Aufrecht’s objections to the date.
Former owner: f. 2o v : Wilson writes : ‘Dono mihi
dedit tanquam novae suae sectae normam, Cuvera
Sinha—Svami Narayani assecla—Rajaputra—Ahmeda-
bodi Guzerattorum Jan. 1822.’
Measurement, Sfc.: this is part 2 of the MS. described
under 507 .
737— MS. Wilson 420cd
Fragments, after A.D. 1820.
Measurement, Sfc.: this is part 3 of the MS. described
under 651 .
Scribe: cf. 484 .
738, 739—MSS. Wilson 289, 290
Susrutasamhita, A.D. 1820.
Contents : edited by Jivananda Vidyasagara, Calcutta,
3rd ed., 1889 ; at Bombay in 1902, and also by Kavi-
ratna and Gupta, vol. I, 1885. Translation by A. F. R.
Hoernle, Bibl. Ind., 1897, &c., in progress. Susruta
appears to have been in existence by the time of the
Bower MS. (a. d. 450), Macdonell, Sansk. Lit., p. 436.
As to Susruta and Caraka, cf. Jolly, Vienna Orient.
Journal, XI, 164—166 ; Levi, Journal Asiatique, 1896 ;
J.R.A.S., 1907, p. 174. On Susruta’s alleged know¬
ledge of the true origin of malaria, see Jolly, J.R.A.S.,
1906, p. 222.
Written by three hands.
Measurement of binding : 1i|- x 6-j in. approximately
for both volumes.
No. of leaves: 289 = ii + 183 + ii blank ; 290 = ii +
186 + ii blank. In the original foliation an attempt
has been made to number each sthana severally, but
this is hopelessly confused.
Bate: 290 , f. 46 v : samvat 1882 ( = a. d. 1826)
tifadhe mdse sukle pakse dvddasyam camdravdsare \
740—MS. Wilson 292a
Part of Nibandhasamgraha, after A. D. 1810.
Contents : Burnell, Tanjore catal., p. 63, first pointed
out that this was part of the Nibandhasamgraha,
a commentary on the Ayurveda. The reputed author
is variously called Dalvana, Bilhana (Burnell’s MSS.),
Dallana, son of Bharata(Mitra, Bikaner catal., p. 651),
Dallana (Weber, Catal., I, 277), Dalana (Biihler, Gujarat
catal., p. 250), &c. It usually claims to be an inde¬
pendent work. Bendall, Brit. Mus. catal., p. 212,
assigns Dallana to about a.d. 1220. Cf. J.R.A.S.,
1906, pp. 693, 700, 933, where a.d. 1160 is suggested.
Edited, Calcutta, 1891.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement of binding: 12 x 9-- in.
Material: paper water-marked ‘ C. Wilmott.’
No. of leaves : iii + 60 + iii blank. The two parts in
the original foliation have 9 + 51 leaves. Arranged like
a European book.
Date : the latest date in the water-mark is 1816 (not
1813), see f. 54, &c., and though this applies primarily
to 744 , it is certain that these two parts were written
at the same time by one hand.
741, 742— MSS. Wilson 298, 299
Astahgahrdayasamhita, A.D. 1790.
Contents: edited by Anna Moresvar Kunte, Bombay,
2nd ed., 1891, who in his preface quotes a verse
from Vagbhata himself showing that Vagbhata’s father’s
name was Simhagupta, Bendall, Journey in Nepal, p. 61,
note. See on MS. Sansk. d. 216 ( 1599 ). Hoernle’s
attempt, J.R.A.S., 1906, p. 940, to date the elder Vag¬
bhata as before I-tsing, has failed, see Jolly, J.R.A.S.,
1907, p. 174, and Hoernle, ibid., pp. 413—417. He
assigns the younger Vagbhata to the 8th cent.
Three hands appear to be traceable: (1) 298 , ff.
1-86; (2) 298 , ff. 119-169; (3) all the rest.
Measurement of binding: i3jX6^in. approximately
for each volume.
No. of leaves:
298 = ii+169 +ii blank. The original foliation
makes 86 + 32 + 51 leaves.
299 = ii + 241 + ii blank. Really 239, as there are
no ff. 147, 148. The original foliation makes 107 +
17 + 116 (really 115, as there are no ff. 48-50, and
ff. 36 and 90 are repeated).
Date: in 298 , f. ii7 v , 299 , ff. I23 v , 24i y , the date
is given : samvat 1852 (= a. d. 1796, not 1794) I
APPENDIX TO VOL. I (735-750)
93
743— MS. Wilson 294
Bhavaprakaia, A. D. 1824.
Contents: edited, Calcutta, 1875; with a Bengali
translation, by K. S. Gupta, 1887, by R. L. Gupta,
1883-1888. The author’s date is very uncertain.
It must be after a. d. 1375, as he quotes Madanapala.
He may belong to the 15th or 16th cent. It is worth
noting that he is apparently not mentioned in Vaidya-
raja’s Sukhabodha (a. d. 1567), Eggeling, India Office
catal., pp. 942, 943, and that the only commentary
mentioned in the Catalogus Catalogorum was composed
under Ranavlra of Kasmlr, after a. d. 1857.
Measurement of binding: 1 ij x 9-^ in.
No. of leaves : i + 448+i blank. Arranged like a
European book.
Date: f. 448 v : sake 1745 ( = a. d. 1823) 1880
maghasuklatrayodasyam 13 guruvasare taddine Bhava-
prakasab samaptab \
744 —MS. Wilson 292 b
Bhavaprakaia, after A.D. 1810.
Measurement, fyc.: this is part 2 of the MS. described
under 740.
745— MS. Wilson 42
Rugviniicaya, after A.D. 1815.
Contents : see Eggeling, India Office catal., p. 933,
who notes that jagadvaidyaka in 740, f. io v , is in all
his MSS. gajavaidyaka. The later limit of date is
fixed by the citations in the Virasimhaloka (a. d. 1383,
Bhandarkar, Bombay catal., p. 125), Bhandarkar, Report,
1883, 1884, p. 87; Aufrecht, Flor. catal., p. 121 ;
and see 740.
Printed, with a Marathi commentary, Bombay, 1862,
and at Calcutta in 1880.
In the centre of each page is the usual blank
square. The verses are numbered.
Measurement of binding: 17 x 6|- in.
Material: yellow country paper.
No. of leaves : ii + 92 + ii blank.
740— MS. Walker 143
Rugviniicaya with Atankadarpana,
after A.D. 1700.
Contents: in the Yirasimhaloka, a semi-medical
work by a Tomara prince of a.d. 1383, a Vacaspati
is quoted who may be this commentator, Bhandarkar,
Report, 1883,188^, p. 87. At least no other vaidya of
this name seems to be known. Cf. also Eggeling, l. c .;
Aufrecht, Flor. catal., pp. 119,120, Leipzig catal., p. 374.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement of binding: 11-| x 6 - in.
No. of leaves: ii + 283 + ii blank.
747— MS. Walker 182»
Rugviniicaya, A. D. 1070.
Contents : the text appears to be written only by one
hand though in two styles, one formal and one cursive.
The text is occasionally bounded on either side by
three red lines. F. ii9 v is blank. There are a good
many later corrections.
Measurement, fyc.: this is part 1 of MS. Walker 182
( 1002 ).
No. of leaves: in this part as originally foliated
there are 122 leaves, but f. 35 is repeated.
Date: f. i23 v : samvat 172 6 ( = a. d. 1670) varse
phalugnasudi 5 somavasare \
Scribe: f. i23 v : likhito’yam gramtha bhatalilarena
( nara 0 is not found) svayarn pathanarthah vastavyam
Javaragrame tigalam 47 1 mate vocdtuapubhakrsTui
(illegible and probably some letters lost) gobhagenasti
samvat 1 (lost) 1 This is apparently the date at which
some owner had it.
748— MS. Wilson 293
S'arngadharasamhita, A.D. 1801.
Contents: see on MS. Sansk. c. 119 (1001).
The text is bounded on either side by two double
red lines. ■
Measurement of binding: 12j X 7| in.
No. of leaves: ii + 145 + ii blank. The original folia¬
tion makes 121 + 24 leaves.
Date : f. 121: samvat 1857 ( = a. d. 1801) phalguna -
krsnacaturdasyam samdpteyam samhita 1
749— MS. Walker 137 f
S'arngadharasamhita (parts) and Kalajnana,
18th cent.?
Contents: the text is bounded on either side by
three red lines. The Kalajnana clearly imitates Sfam-
bhunatha’s work, as in 753.
Measurement, fyc.: this is part 6 of the MS. described
under 708.
Scribe : cf. 700.
750— MS. Wilson 290
Siddhayoga, 19th cent. P
Contents : the title is Siddhayoga, see on 849, 850.
It follows the order of Madhava’s Rugviniscaya, see
94
CATALOGUE OF
Eggeling, India Office catah, p. 937. It is anterior to
the Virasimhfdoka, a. b. 1383, Aufrecht, Flor. catah,
p. 121. The text is apparently written by two hands:
(1) ff. 1-5^, 95 V-I0 3 V i ( 2 ) ff - 56 v - 95 v -
The text is bounded on either side by three or four
black lines. ■ “
Measurement of binding: 13x6 in.
No. of leaves: ii + 103 + ii blank. The original folia¬
tion makes 104, but there is no f. 94.
751— MS. Wilson 49
Prayogamrta, after A. D. 1815.
Contents: there is another MS. mentioned by Stein,
Kasmir catah, p. 184.
In the centre of each page is a blank square space,
in imitation of a palm-leaf MS.
Measurement of binding : 19§ X 5^ in.
Material: yellow country paper.
No. of leaves : ii + 305 + ii blank.
752— MS. Walker 181 f
Yoga&ata, A.D. 1711.
Contents : the version of the Yogasata here presented
is evidently a working up of that mentioned by Eggeling,
India Office catah, pp. 933 sq.; Mitra, Notices, IX,
204; Burnell, Tanjore catah, p. 67b; Weber, Catah,
I, 296, 297 ; and found in the Ceylon recension (Bendall,
Sanskrit §c. Books, p. 492 a ). Cf. on MS. Sansk. d.
207 ( 1606 ). For another modified recension, see Mitra,
Notices, II, 276.
The text is bounded on either side by two dark
red lines. ■
Measurement, fyc.: this is part 6 of MS. Walker 181
( 1046 ).
Bate: f. 174: samvat 1767 ( = a. d. 1711) varse maga -
siravadi 13 dine \
Scribe : f. 174: likhitam Bevacamdrena 1 srinavana-
garamadhye \
753— MS. Walker 181°
Kalajnana, A.D. 1763.
Contents : see Eggeling, India Office catah, pp. 901,
948, 949. Apparently similar are the texts described
by Mitra, Bikaner catah, pp. 644, 645, Notices, VIII,
138; Aufrecht, Flor. catal., p. 120; but clearly the
work exists in several different recensions, Leipzig
catah, p. 373. Sambhu is probably Sfiva.
The text is bounded on either side by three dark
red lines. ■
Measurement, Sfc. : this is part 3 of MS. Walker 181
( 1046 ).
SANSKRIT MSS.
Bate: f. 89 : samvat 1819 nd varse sake 1684 (= a.d.
1762) pravarttamanye asvanavadi 10 bhaume \
Scribe : his name is erased on f. 89, but he is called
sriparsvaprasadat 1 and was therefore probably a Jaina.
On f. 86 v the name is given : srirupavardhana lisitam 1
Character : Jaina Devanagari.
754— MS. Walker 181d
Vaidyajivana, A.D. 1708.
Contents : cf. MS. Sansk. g. 3 ( 1092 ). The work
was possibly composed under a Harihara of Vijaya-
nagara, 14th cent., Bendall, Brit. Mus. catal., p. 215.
The text is bounded on either side by three red
lines, and there are a few interlinear glosses.
Measurement, fyc. : this is part 4 of MS. Walker 181
( 1046 ).
Bate: f. I09 v : samvat 1764 ( = a. d. 1708) varse
suklapakse saptamidine sukre I Name of scribe deleted.
Character : Jaina Devanagari.
755 — MS. Marsh 328°
Vaidyavallabha, A.D. 1653.
Contents : see Eggeling, India Office catal., p. 960;
Bendall, l. c. ; Mitra, Notices, IX, 152, where the
colophon attributes the work to a srivaikunthasrama-
sisya Ratulasarhgadhara. It is probably a 16th cent,
production. The name of the author’s father is Deva-
raja, as here and in Aufrecht, Leipzig catal., p. 377.
The reference of Hoernle, J.R.A.S., 1906, p. 939, to
this MS. is incorrect.
The text is bounded on either side by two red lines.
Measurement, Sfc. : this is part 3 of the MS. described
under 735 .
Bate: f. i88 v : 1709 ( = a. d. 1653) var ? e dsa-
dhasuddhadvadasyam some likhitam idam l Cf. 328.
756 — MS. Walker 20ie
S'atafiloki with Candrakala, 18th cent. P
Contents : see on MS. Sansk. d. 220 ( 1602 ).
From f. 118 the text is bounded on either side by
two red lines. F. i a is certainly a modern addition.
On f. 99 an interlinear paraphrase is begun, but not
continued. -
Measurement, Sfc. : this is part 7 of the MS. described
under 610 .
757— MS. Walker 137 h
S'atafilokl with Candrakala, 18th cent. P
Contents : the real title of the work is simply
Satasloki, and the $Ika, by the author himself, is called
APPENDIX TO VOL. I (750-764)
95
Candrakala. Cf. Weber, Catal., II, 3^4; Burnell,
Tanjore catal., p. 67 a .
The text is bounded on either side by three red lines.
The gramthagra is 1050.
Measurement, fyc.: this is part 8 of the MS. described
under 708.
Date: probably about a.d. 1750.
Scribe: f. i yj y : bhatafrl 5 vidyadharasutabhamna-
jikena likhitd I Cf. 700.
758— MS. Walker 137s
Samnipatakalika, 18th cent. ?
Contents: the text is bounded on either side by
three red lines. Another recension of the work
appears to be contained in the text in 96 verses
described by Aufrecht, Flor. catal., p. 121, where it is
attributed to the Asvinikumara. Cf. Leipzig catal.,
p. 373; Eggeling, India Office catal., no. 3712.
Measurement, fyc.: this is part 7 of the MS. described
under 708.
Scribe: cf. 700.
759— MS. Wilson 423
Anandakanda, 18th cent. P
Contents: this work is apparently from the Bhairava-
tantra, see Burnell, Tanjore catal., p. 70.
The text is bounded on either side by two light red
lines. The paper is of a yellow tinge. The binding
has been put on upside down.
Measurement of binding: 11 j X 4j in.
No. of leaves: ii + 128 + ii blank.
760— MS. Walker 137 e
Dhaturatnamala, 18th cent.?
Contents: cf. Mitra, Bikaner catal., p. 637, where
verse ih = verse 3 a here.
The text is bounded on either side by three red lines.
Measurement, Sfc.: this is part 5 of the MS. described
under 708.
Scribe : perhaps 749,767,768,700 are by one hand.
761— MS. Walker 178*
Basarajalaksmi, 18th cent. P
Contents: the text is corrected in a few places by
a later hand.
The work must be fairly old, as Stein, Kasmtr catal.,
p. 188, mentions a MS. of samvat 1739 ( = a.d. 1683).
Measurement of binding : 11| x 6| in.
No. of leaves: ii +113+ iii blank. In the original
foliation the two parts have 43 + 69 leaves.
762—MS. Walker 160 b
Basendracintamani, 19th cent. P
Contents: cf. MS. Sansk. d. 219 (1007). The work
is quoted in the Yogatarahgini of Trimalla, whose
son’s work, Rasaratnapradipa, is quoted by the famous
Todarananda, Bendall, Brit. Mus. catal., p. 212.
Chapters 1, 2 (no. 3 is not marked), 4-9, end on
ff. 5o v , 52, 63V, 66, 67, 7i v , 77, 132. Lacunae are
occasionally marked, e.g. on ff. 55, 56, 57.
Measurement, Sfc.: this is part 2 of the MS. described
under 700.
Scribe: by the same hand as part 3.
763— MS. Wilson 43
Basendrakalpadruma, after A. D. 1816.
Contents : cf. also Mitra, Notices, YI, 227, 228.
As the author is quoted in the Sukhabodha of
Vaidyaraja (Aufrecht, Catalogus Catalogorum, II, 116),
he must be anterior to Vaidyaraja. That author dates
himself in the year 1624 ( jaladhidvidvit§afrtyabdake ,
Eggeling, India Office catal., p. 943 a ), which seems to
be most probably—from the custom of authors and
scribes—a samvat year, i. e. = A. d. 1568.
Measurement of binding: 17^ x 6| in.
Material: yellow country paper.
No. of leaves: ii+ 149 4-ii blank. The original folia¬
tion is 1-110, 100-138.
764— MS. Walker 200s
Yogaratnamala, with a commentary, 18th cent. P
Contents: Gunakara was not a Bauddha, but a
Svetambara Jaina, as the epilogue shows. See for
the work, Weber, Catal., II, 317; Mitra, Notices, II,
276, Bikaner catal., pp. 569, 574, 628. This MS. has
been collated by Dr. Friedlander, Berlin.
The text is placed in the centre of each page, with
the commentary at top and bottom. It is bounded on
either side by three or four red lines.
Measurement, fyc.: this is part 7 of the MS. described
under 68.
Character: Devanagarl, with a very few Jaina
characteristics.
96
CATALOGUE OF SANSKRIT MSS.
765— MS. Wilson 297
Rajanighantu, 19 th cent.?
Contents : see Eggeling, India Office catal. , p. 977.
Lithographed, Benares, 1883, and edited in Anandd-
Sratna Sanskrit Series, 1896. Garbe has edited and
translated varga XIII, on minerals, Leipzig, 1882. He
assigns the author to the reign of Simhadeva Nrsimha
of Kasmir, between a. d. 1235 and 1250. Aufrecht,
Z.D.M.G., XLI, 487, however, puts him after Madha-
vavinoda, a.d. 1374* Cf. J.R.A.S. , 1906, p. 94°»
where he is assigned to the 15th cent.
The text is bounded on either side by a broad red
line over two black lines.
Measurement of binding: 14-j X 6^ in.
No. of leaves : ii 4-133 4- ii blank.
766, 767— MSS. Wilson 287, 288
Rajanighantu, A.D. 1813.
Measurement of binding: 287 = 1 iy x 8|- in.; 288 =
ii-jX 8-j in.
No. of leaves : 287 = i 4-267 4-i blank ; 288 = iii 4-
1344-iii blank. Arranged like a European book.
Bate: 287, f. : samvatsaram 1869 (=a. d. 1813).
768— MS. Walker 137 a
Vrksayur veda, 18th cent.?
Contents: the text is bounded on either side by two
double red lines. There are a few lacunae marked.
Can Surapala, son of Bhimapala, of the Pala-Rathor
dynasty of Budaun, be meant ? Duff, Chronol. of India,
p. 299. A Vrksayurveda is known to the Sarnga-
dharapaddhati, a. d. 1363, and to the Kuttanlmata of
Damodaragupta, a. d. 780.
Former owner : f. 30 v : Rrparamakuarakasya pusta-
kam idarn \
Measurement of binding : 10 X 5^ in.
No. of leaves : ii 4- 215 4- ii blank. The nine parts in
the original foliation have 30 (4-i blank) 4-16 (4-i
blank) 4- 43 4- 20 (really 15, as ff. 1, 5,10,11,15 are lost)
4-ii4-2i (really two parts, ff. 1-5, 5 v -2i)4-394-38
leaves.
769— MS. Wilson 839 b
Aryasiddhanta, 19th cent. P
Contents: this MS. contains (A) the Da^agltisutra,
(B) the Ganitapada of the Aryastasata part of the
Laghvaryabhatiya, composed in a. d. 499 in Kusuma-
pura by the author at the age of twenty-three. Edited
by Kern, Leyden, 1874, with the commentary of Para-
madlsvara. See Hall and Whitney, Journ. Am. Or. S.,
VI, 559 ; Kern, Brhatsamhitd, pp. 54 sq.; Bhau Daji,
J.R.A.S., I, 392 ; Aufrecht, Cambridge catal., p. 38 ;
Weber, Catal., II, 287 ; Eggeling, India Office catal.,
p. 992; Thibaut, Astronomie, pp. 54, 55; Mitra,
Notices, IV, 142.
The MS. is not very good, and there are several
lacunae. The correct spelling is of course Aryabhata.
Measurement, fyc. : this is part 2 of the MS. described
under 771.
770— MS. Wilson 638
Aryasiddhanta, A.D. 1834.
Contents: this is the Mahasiddhanta, Kern, Brhat¬
samhitd, p. 59 ; Hall, Journ. Am. Or. S., pp. 556 sq.;
Mitra, Notices, IV, 144; Weber, Catal., II, 288, Ind.
Lit., p. 257, n. 284. As against Bentley’s date,
a. d. 1322, S^. B. Dlksit has shown that the work belongs
to the period between Brahmagupta (cf. J.R.A. S., 1907,
p. 413) and Bhaskara, Thibaut, Astronomie, p. 56.
Corrected here and there by Dr. Hall.
Measurement of binding : iof- X 7 in.
No. of leaves : iii 4- 20 4- iv blank. Arranged like a
European book.
771— MS. Wilson 639 a
Aryasiddhanta, 19th cent. P
Measurement of binding : 8 X 4-| in.
No. of leaves: iii4-564-iii blank. The two parts
have 47 (4-1 blank) 4- 7 (4-1 blank) leaves.
772— MS. Mill 11
Suryasiddhanta and Kiranavali, after A.D. 1816.
Contents : this MS. of the Suryasiddhanta was
written not for this commentary, but for that in 773,
as is proved by the fact that the foliation of 773 is
from f. 19 onwards, while this commentary has a
separate foliation.
For Dadabhai, who wrote in a.d. 1719, see Bhan-
darkar, Report, 1883, 1884, p. 84; Eggeling, India
Office catal., p. 997 ; Aufrecht, Cambridge catal., p. 44.
Measurement of binding : 16^ x 4^ in.
Material : yellow country paper.
No. of leaves : i 4-128 4-i blank. In the original
foliation 1-18 and 1—no.
APPENDIX TO VOL. I (765-780)
97
773— MS. Mill 12
Commentary on Suryasiddhanta, after A.D. 1815.
Contents: see Eggeling, India Office catal., p. 998,
who gives the date of composition—from Colebrooke—
as a.d. 1571 ; Mitra, Notices, V, 127; and on MS.
Sansk. d. 214(1620).
Measurement of binding: i6j- X 4^ in.
Material: yellow country paper.
No. of leaves: i+184 + i blank. Originally foliated
as 19-202.
774— MS. Walker 102d
Karanakutuhala, 17th cent. P
Contents: see on MS. Sansk. d. 200 (1530); Bendall,
Brit. Mus. catal., p. 186.
The text is bounded on either side by two black lines.
Ff. 11, 12 in the original foliation seem to have been
added by a later hand. The slokasamkhya is given as
630. -
Former owner : f. 121 v : bhattaraghundthasyedam 1
Measurement, 8fc.: this is part 4 of the MS. described
under 207.
775— MS. Walker 208^
CandrarkI, 18th cent.?
Contents: Dinakara composed the Khetakasiddhi
in a.d. 1578, see Bhandarkar, Report, 1882, 1883,
pp. 27, 28.
The MS. is apparently written by two different
hands: (1) ff. 59 v -6i, (2) ff. 61^-6^. The text is
bounded by a red line between two black lines in the
latter part, and by a red or black line in the former part.
Measurement, Sfc.: this is part 2 of the MS. described
under 200.
776— MS. Walker 190 b
Tithisaranika, A.D. 1540.
Contents: if Aufrecht’s dating is correct, as is most
probably the case, it gives a. d. 1055 as the last year
of Bhoja’s reign, cf. Duff, Chronol. of India, p. 109,
note.
The text is bounded on either side by two black lines.
Measurement, 8fc.: this is part 2 of the MS. described
under 208.
Bate: f. 134: svasti srisamvata 1596 ( = a. d. 1540)
varse karttagasudi 4 catuthi varadhe 1
Scribe : f. 134 : raP visnyatha 0 pothl \
BODL. SANS. CATAL. APP.
777 , 778— MSS. Walker 145, 140
Commentary on Brhatsaanhita, 18th cent. P
Contents : the text of the Brhatsamhita was edited
by Kern, Bibl. Ind., 1865, translated, J.R.A.S., New
Series, IV-VIII, and by Chidambaram Iyer, Madura,
1884. Mahamahopadhyaya Sudhakara Dvivedin began
an edition with the commentary of Bhattotpala, Benares,
1895, &c. On Bhattotpala cf. Kern’s preface, p. 61.
This MS. contains three verses of commentary on
chapter 45, and then ends thus : iti bhdsyasya purvdrd-
dham l uttararddham aparasmima pustake vilokaniyam 1
There are several lacunae.
Measurement of binding: 11| X 7 in. approximately
for both volumes.
No. of leaves : 145 = ii + 187 + ii blank ; 140 = ii 4-
208 4-ii blank. The original foliation counts 396,
ff- T 3°) T 3 I being one leaf only.
779— MS. Walker 207 a
Brhajjataka, 17th cent. ?
Contents: see on MS. Sansk. d. 199 (1507); Kern,
preface to Brhatsamhita, p. 2 6; Thibaut, Astronomie,
pp. 67-69. Text translated by C. Iyer, Madras, 1885.
The MS. is very untidy, many notes being written
in the margins. The text is bounded on either side
by two black lines.
Measurement of binding: io|- X 6 in.
No. of leaves : ii 4-1304-ii blank. The three parts
in the original foliation have 36 (really 37, f. 14 being
repeated) 4- 57 4- 34 leaves.
Scribe : f. 37 v : srigurujhatiyandripattanasthapatha-
kopapadaharikrsnatmajaharidevdtmajadevesvarena likhi-
to ’yam gramthafy 1 svapathanartham paropakdya ca I
780— MS. Walker 105
Brhajjataka with Cintamani, 18th cent. ?
Contents: on f. ii v the Greek names of the signs
of the Zodiac appear, cf. Brown, Carnatic Chronol.,
p. 23. Aufrecht suggests that perhaps Sphujidhvaja
is identical with Yavanesvara, but see on 781.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement of binding : 111 x 6| in.
No. of leaves : ii 4- 288 4- ii blank.
Bate: perhaps this MS. is by the same hand as 25.
o
98
CATALOGUE OF SANSKRIT MSS.
781— MS. Wilson 427
Minarajajataka (part), A. D. 1090.
Contents: for a MS. of the whole see Eggeling,
India Office catal, pp. 1096, 1097 ; also Mitra, Notices,
X, 222 (cc. 5-46); V, 272 (strijutakayogadhyayd) ;
VII, 211 ( strlnaksatraphala, &c.); Bhandarkar, Report,
1883, 1884, p. 273, no. 211 (complete); Bendall, Brit.
Mas. catal., pp. 200, 201 (imperfect at the end). The
Benares College fragment consists of one leaf. Hara-
prasada Sastrin, Journal As. Soc. of Bengal, LXVI,
pt. i, 311, mentions a complete copy on palm-leaves in
the library of the Maharaja of Nepfd, at the end of which
it is stated that Yavancsvara in the year 91 of some
unnamed era translated a Yavana book into Sanskrit,
and that Sphurjjidhvaja then put this translation into
4,oco Indravajra verses (Mitra, l. c ., X, 222, estimates
the total as 3,849 slokas) in 191 of that era. This
note is distinctly against the usual (Kern, Aufrccht)
identification of these authors proposed by Utpala, and
again confirms Jacobi’s view regarding the dependence
of India upon Greece for its jataka and hora works,
Thibaut, Astronomic, pp. 67-69. Kern, Brhatsamhitd,
p. 48,thinks Sphujidhvaja is Aphrodisius. Cf. Harapra-
sada, Report, 1891-1895^.8; J.R.A.S., 1907, p. 1084.
The text is bounded on either side by two red lines.
Measurement of binding: 13- x 5^ in.
No. of leaves: ii+ 142 + ii blank. Originally foliated
as 1-141 and 205.
782— MS. Walker 192°
Jyotisaratnamala, 17th cent. ?
Contents : see on MS. Sansk. c. 103 (1531).
The text is bounded on cither side by three red lines.
Measurement, fyc. : this is part 5 of the MS. described
under 792.
Injuries: f. 148 is torn badly at the left side.
783— MS. Sansk. d. 23
Jyotisaratnamala, A. D. 1044,
Contents : see 1532. This MS. was formerly MS.
Walker 214.
784—MS. Wilson 428
Tajikasarasudhanidhi, A. D. 1831.
Contents: carelessly written.
Narayana flourished about a. d. 1730, see 772. The
title should be spelt Tajika 0 , not Tajaka 0 .
No. of leaves: ii + 79 + ii blank. The original folia¬
tion counts 80, but there is no f. 49.
Bate: f. 79 v : samvat 1887 ( = A. d. 1831) niiti
mdrgasirsavadi 12 lesakasri I
785— MS. Walker 12 8 b
Naksatrasamuccaya, A. D. 1513.
Contents : the text is bounded on either side by two
faint red lines. There is some scribbling on ff. 17,
27 v by a modern hand.
Measurement of binding : io-| x 6^ in.
No. of leaves: ii + 131 4-ii blank. The four parts
have 164-13 (really 11, as ff. 2, 5 are lost) 4- 56 4- 46
leaves.
Character: Jaina Dcvanagarl.
Injuries: ff. 2, 5 are lost.
786— MS. Walker 157 b
PraSnarnava, after A. D. 1790.
Contents: cf. MSS. Sansk. d. 196 , 208 (1554,1555).
Measurement, fyc.: this is part 2 of the MS. described
under 40.
787— MS. Walker 210 b
Muhurtamartanda, 18th cent. P
Contents: this work is the Muhurtamartanda with
the author’s own commentary, Muhurtamartandavalla-
bha, and the quotations should be separated as in the
Bombay edition, 1861 (Aufrecht).
The date in Weber, and in Eggeling, India Office
catal., p. 1075, * s sc&a 1494. Mitra, Notices, V, 26,
gives the poet’s genealogy and the date saka 1484.
The dates of composition are a. d. 1572 for text, 1573
for commentary, Aufrecht, Leipzig catal., p. 330.
Two or three hands seem to have written the MS.
The text is bounded on either side by two black lines.
Measurement, Sfc.: this is part 2 of the MS. described
under 203.
788— MS. Walker 184
Muhurtacintamani, 18th cent. ?
Contents: see Eggeling, India Office catal., p. 1072 ;
Bendall, Brit. Mus. catal., p. 204; Aufrecht, Leipzig
catal., p.326. Edited in India, e. g. Bombay, 1880.
The text occupies the centre of each page, the
commentary the top and bottom.
Measurement of Hading : 14^ x 6| in.
Measurement of binding: 12^ x 7| in.
No. of leaves: ii 4- 280 4- ii blank.
APPENDIX TO VOL. I (781-796)
99
789— MS. Wilson 315
Muhurtacintamani, A. D. 1821.
Contents: the text is bounded on either side by
two red lines. F. i is ornamented, and there are
diagrams on ff. 3, 3 V , 4, 6 V , 8, 10, i2 v , i3 v , I4 V , i6 v ,
i8 v , 21*, 23, 24, 25 v , 27 v , 45 v , 47 v > 5 ° y > 5 lV > 53 v >
54V 61, 62, 75, 77 v . _
Measurement of binding : iij x 6| in.
A T o. of leaves : ii 4- 79 4- ii blank.
Bate: f. 79: sam 1877 ( = a.d. 1821, not 1822)1
Scinbe: f. 79: likhitam idam pustakah Kdsydm
madhye Krsnacamdrasydtmajalaghupamditasyopandmnd
Bayacamdrena I
790— MS. Walker 159“
Muhurtadipaka, A. D. 1800.
Contents : cf. Eggeling, India Office cat ah, p. 1075 5
Aufrecht, Leipzig catal., p. 329. His father’s name
was Kamhajit Vadava. Text and commentary printed
at Benares in 1867. _____
Measurement of binding : 11|- X 7 in.
No. of leaves : ii 4- 172 + ii blank. The three parts
in the original foliation have 46 4- 85 4- 39 leaves.
Bate : f. 46 v : samvat 1857 sake 1722 (= a. d. 1800)
pravarttamanye bhadrapadamase krsnapakse 11 ravau \
Scribe : f. 46 v : Gujatamadhye Amadavadasya pusta-
kam likhitva l Uttarardmatmajaparasuramena likhito
9 yam gramtham \
791— MS. Walker 181®
Vivahavrndavana, 10th cent.?
Contents: see Mitra, Notices,VII, 212,213; Aufrecht,
Leipzig catal., p. 317. On Kesava cf. Bhandarkar,
Beport, 1883,1884, p. 83, where saka 1418 is given as
the epoch year used by him, but Kamalakara as his
father’s name, and Nandigrama as his home. Aufrecht,
Catalogus Catalogorum, pp. 127, 128, distinguishes
between Kesavarka and Kesava Daivajna, but they are
really identical, see ibid., IT, 25 ; Sudhakara, Ganakata-
rangini, p. 53 ; Bendall, Brit. Mus. catal., p. 206. See
also on 820.
Measurement, fyc.: this is part 5 of the MS. described
under 497.
792— MS. Walker 192»
S'uddhidipika, 18th cent.?
Contents: see Mitra, Notices, I, 184; Eggeling,
India Office catal., p. 1068 (8 adhyayas). Aufrecht,
Catalogus Catalogorum, p. 671, gives a. d. 1158 as the
date of composition of the Ganitacudamani, but on
what authority does not appear.
The text is bounded on either side by two double
black lines.
Measurement of binding : 8 x 5^ in.
No. of leaves: ii 4-156 4- ii blank. The five parts of
which the volume consists have 48 4- 30 + 7 4- 24 4- 45
leaves.
793— MS. Walker 213 b
Svaratattvodaya, A. D. 1040.
Contents: the text is bounded on either side by
three dark red lines.
Measurement, §c.: this is part 2 of the MS. described
under 270.
Bate: f. I5 V : samvat i6gy sake 1562 ( = a. d. 1640)
pravartlamdne uttarayane bhdnau I grismartau I dsddha-
mase \ krsnapakse 8 somavdsare I
Scribe: f. I5 V : pustakam idam, lisitam I bhatasiva-
dasa tasya putrapitambarena l bhatasrlharisramapatha-
ndrtham I
794— MS. Walker 178 b
Jatakapaddhatyudaharana, after A. D. 1700.
Contents: cf. on MS. Sansk. d. 189 (1572). The
text is illustrated by many diagrams.
Measurement, fyc.: this is part 2 of the MS. described
under 781.
795—MS. Mill 42 d
Kakarudrasamvada, A. D. 1854.
Contents : f. 103 is on yellow paper.
Measurement, fyc.: this is part 4 of the MS. described
under 71.
Bate : f. no : 1910 ( = a. d. 1854 if it is a Vikrama
date; whence 1832 of the Bodl. catal. is derived does
not appear) \
796—MS. Walker 157
Romakasiddhanta (part), A. D. 1781.
Contents: this is of course merely a late forgery
under a venerable name. Cf. Thibaut, Astronomie,
p. 42 for the original, p. 57 for Srlsena’s recension ;
for this see Eggeling, India Office catal., p. 1061 ;
Kern, Brhatsamhita, p. 47 ; Bendall, Brit. Mus. catal.,
p. 210.
The text has many lacunae, and is very inaccurate
throughout. _____
Measurement, 8fc.: this is part 4 of the MS. described
under 40.
100
CATxYLOGUE OF SANSKRIT MSS.
797— MS. Wilson 425
Rekhaganita, A. D. 1821.
Contents : see Eggcling, India Office calal. , p. 1023,
J.A. VI, 940. Edited by K. P. Trivedi, Bombay,
1901, 1902. The author translated the Almagest from
the Arabic in 1730, cf. Aufrecht, Cambridge caial., p. 75.
Blank spaces are left for the figures.
Measurement of binding : 1x 8y in.
No. of leaves: ii + 172 + ii blank. The original folia¬
tion makes 180, but ff. 1-8 are lost.
Late and Scribe: f. 172: samdpto * yam gramthah
subham bhuydt suga (l)-vasunagabhuvarse sucisuk/e yuga-
tithau raver vdre l vyalikhat Tokamanih kila samrdjdm
ujfiayd pustam l iti srlsamata 1877 (=a. d. 1821) sala-
mhghavadi dvddasivdra mamgarakarakelih I
798— MS. Wilson 380
Kundamandapasiddhi, A. D. 1817.
Contents : see Eggeling, India Office calal ., p. 1143 ;
Mitra, Notices, VII, 101-103 ; Aufrecht, Leipzig catal.,
pp. 235, 236; Burnell, Tanjore catal., p. 63 s1 ; Bhan-
darkar, lleport, 1883, 1884, pp. 52, 53, who gives his
father’s name as Buba. Printed in Kuncjagranthavim-
sati, pp. 1 sq.
The text is bounded on either side by two double
red lines.
Measurement of binding: 10x5 in.
No. of leaves : i + 41 +i blank.
Late : f. 41 v : sainvat 1863 ( —a.d. 1807) bhddra
8 (?) suklapaksa 1
799— MS. Walker 191 c
Lekhakamuktamani, A. D. 1625.
Contents : the text is bounded on either side by
two or three red lines. There are many diagrams
inserted to explain the text.
Measurement, fyc. : this is part 3 of the MS. described
under 384 . The leaves of this part are arranged as
in a European book.
Late: f. i5o v : samvat 1681 ( = a. d. 1625) varse
jyesthavadi 4 some likhitum l
Scribe : f. 1 jO v : Rupapuranivdsind Levajikena I
Injuries : ff. 44, 45 are lost.
800— MS. Mill 5
Yuktikalpataru, after A. D. 1810.
Contents : see Mitra, Notices, I, 146, 147, where the
termination is exactly the same as in this MS., so
that hardly anything can be missing. Ff. 1, 2 contain
a list of contents. —
Measurement of binding : i6| X 3-7 in.
Material: yellow country paper.
No. of leaves: i+115 (really 117, as two ff. are
prefixed) 4- i blank.
801— MS. Fraser 41
Bhagavadgita, 18th cent.?
Contents : it begins namo bhagavate I Then follow
the so-called malamantras, for which see Schlegel,
second edition, pp. 290 sq.; Lodi, catal., p. 3 ; YVeber,
Catal., I, 109; Eggcling, India Office catal., p. 1160.
Then begins the Gita. The cantos are carefully
marked, and the MS. is by no means inaccurate, but
it is written in a most painfully minute hand. The
MS. is bounded on either side by lines of gold, which
are thick at the beginning of the roll, but gradually
become thin. It may be compared with the MS.
which once belonged to Schlegel, see Weber, l. c. The
best edition of the Gita is still that of J. C. Thomson,
1855, whose translation is also good, but should
be compared with those of Telang, S.B.E., VIII;
Garbe, Leipzig, 1905, and Deussen and Strauss, Vier
Lhilosophische Tcxte des Mahdbhdratam, 1906. See
also Hopkins, J.R.A.S. , 1905, p. 384, Great Epic,
ch. iii; Keith, J.R.A.S., 1907, p.462.
Former shelf mark : MS. Sansk. g. 2 (R). Formerly
and now again Fraser 41.
Kept in a glass case inside a wooden box.
Size of wooden box : 2f X if X if in.
Size of MS. : a roll about 98 in. long and if in. broad.
Material: paper, thin but strong.
Ornamentation : the beginning of the roll contains
seven pictures;- (1) Ganesa sitting, (2) Brahman with
four heads, also sitting, (3 and 4) apparently two views
of Visnu and Laksmi, (5 and 6) apparently two views of
S'iva and Durga, (7) Arjuna silting, facing Krsna. Cf.
Weber, /. c.
Late : there is nothing to aid in determining the
date. Possibly it may belong to the end of the 18th
cent. At any rate it cannot be much—if at all-
older, and may be later.
802— MS. Fraser 7
Bhagavadgita, A. D. 1739.
Contents : the text is surrounded by a gilt border.
Measurement of binding : 5f x 3^ in.
No. of leaves : iii 4- 54 4- v blank. Arranged like a
European book.
Late: f. 54: samvat 1795 (=a. d. 1739) varse
pausamase suklapak$e saptamitithau bhrguvasare I
Scnbe : he wrote also 808, 828, 847, and MS.
APPENDIX TO VOL. I (797-810)
101
Fraser 34 (f. 21: samvata 1795 varse sake 1660
[ = a. d. 1738] pravarttamane margasirsamase suklapakse
9 tithau bhrguvasare). MS. Fraser 35 was written by
his pupil Vadyaji, as were also MSS. Fraser 36 and 38.
The last (f. 8 V ) gives the spiritual genealogy in the
Mallumpakhyagacha as S'ivaji, Suryamallaji, Raja-
dharaji. He was of course a Jaina, and all his MSS.
show the Jaina style of letters.
803— MS. Wilson 540
Bhagavadglta, 18th cent.?
Contents: the text is bounded on either side by two
double red lines. ——
Measurement of binding : 47 x 3^ in.
No. of leaves : i 4*5 + i blank. There are 7 lines to
a page, 13 or 14 aksaras to a line.
804-806— MS. Fraser 8
Ramayana, Vol. II, A. D. 1433 ; Vol. Ill, A. D. 1540.
Contents: see on 39-41, and on MS. Sansk. b. 28
(1107). The Ramayana was popular among Buddhists
in a. d. 400, J. B. A. S., 1907, pp. 99-103. F. 2 of vol. I
seems to be by a later hand.
The text is bounded on either side by two red lines
in vols. I and III, by two black lines in vol. II. All the
volumes are a good deal corrected by a later hand.
Measurement of binding:
I 3l x * n - f° r v °l s * I an( * HI.
ii|X7 in. for vol. II.
No. of leaves:
Vol. I = ii -f- 78 -h ii blank. Also numbered 228-
306 (but no f. 262) in the original foliation.
Yol. II = ii 4-190 + ii blank.
Yol. III = ii + 102+ ii blank. Also numbered 545-
646 in the original foliation.
Date:
(1) Yol. II, f. 189V: samvat 1489 ( = a. d. 1433)
varse phafgunasudi 2 dvitiydm tithau gurudine 1
(2) Vol. Ill, f. I02 v : samvat 1596 (=a. d. 1540)
caitravadi 4 sukre \
Scribe:
(1) Vol. II, f. i89 v : the name has been carefully
obliterated, leaving only atmabodhanartham sumdara-
kamdam likhitam l The owner is given on f. 1: Vya-
bhaldputrajayardma I
(2) Vol. Ill, f. io 2 v : adyeha Stambhatirthavasta-
vya (obliterated) °jhdtiyena (obliterated) kritam Bama-
kathaparanam upakdraya Bamaprityai ca l The ob¬
literated spaces are filled up by a much later hand with
the words srlgaudajhatlyena vikritam Vyasatrambakat-
majena Visnudattena mulyena \ For Visnudatta(ka) cf.
probably 845.
807— MS. Fraser 12
Jalandharopakhyana, 16th cent. P
Contents: the text is bounded on either side by
two black lines. Ff. 4 V , 5 V are blank.
Measurement of binding : 9-^x5 in.
No. of leaves: iii + 61 -f-iii blank. In the original
foliation there are 60 leaves, but ff. 1—4 have been re¬
placed by ff. 1-4, 4.
808— MS. Fraser 32
Svapnadhyaya, A. D. 1739.
Contents: see on MS. Sansk. d. 215 (1584). Ff. i v -2
are decorated with a very pretty flower pattern, and
the text throughout is surrounded by a red line.
Measurement of binding: 5^ x 3^ in.
No. of leaves: ii + 44-v blank. Arranged like a
European book.
Date : this is an inference from 802.
809, 810— MS. Fraser 2
Bhagavata Purana, A. D. 1400, 1407.
Contents: on this Purana cf. Roussel, Cosmologie
hindoue d’apres la Bhagavata Purana , Paris, 1898.
Best edition, Nirnaya Sdgara press , 1904. Aufrecht,
Catalogus Catalogorum , pp. 402, 793, points out that
Hemadri is the first author to recognize it; cf. Bendall,
Brit. Mus. catal. } p. 34. Skandha II has been sup¬
plied by a later hand, occupying 16 ff., instead of 22,
as in the original.
The text is bounded on either side by two red lines.
Many corrections and glosses have been written in
by later hands. ■■■.. —1—
Measurement of binding : 13 j x 6| in.
No. of leaves:
Vol. I = ii+ 189 + ii blank. In the original folia¬
tion 40+16, 63-196 (f. 152 lost).
Vol. II = ii, 190-374, ii blank. In the original
foliation 255-361, 56 + 22.
Date:
(1) Vol. I, f. 189^: samvat 1462 ( = a.d. 1406)
varse caitrasudi 4 bhaumadine l Probably skandha II
is not more than 20 or 30 years later.
(2) Vol. II, f. 216: samvat 1461 ( = a. d. 1405)
varse srdvanavadi 12 sukradine \
(3) Vol. II, f. 252: samvat 1460 ( = a. d. 1404)
varse bhddrapavadi 4 ravau \
(4) Vol. II, f. 296 : samvat 1460 varse asvinasudi
2 sanau \
(5) Vol. II, f. 352 v : samvat 1463 ( = a. d. 1407)
varse margraktdi 14 budhe I
(6) Vol. II, f. 374 v : samvat 1463 varse mdgha-
sudi 3 budhe \
102
CATALOGUE OI
Scribe: besides the facts noted in the Bodl. catal.
see—
(1) Yol. II, f. 252 : adyeha srldevapattanamamda-
lukarane mahdrdjasrlbrahmaddsavijayardjye amatya-
pamca ( T)-kulapratipattau Prdgvdtajndtlyamahamsara -
vanasutamahdmmaldkena sribhagavatasamhituydm pu-
nyahetave srlvisnuprityartham pustikd likhita \ For
Prdg 0 cf. MS. Prakrit d. 9.
(2) Yol. II, f. 352 V : adyeha srighoghdveldkule
mahamajayasihapautramahamsaravanasutamahammeld-
ke/ia Vydsaprahnarsimisranum pathandrtham punya-
hetave srlekddasaskumdhasya pustikd samarppitd 1
(3) Yol. II, f. 374 v , where Vydsa 0 recurs and
amatya tf)-pamcakulapratipdttau I It may be amasya \
According to two notices, very much confused, on vol.
I, f. 130, and vol. II, f. 353, a former owner was Gopala,
son of Pitambara, son of Vasa, son of Saga or Samga.
811, 812 —MSS. Walker 215, 218
Bhagavata Purana with Bhavarthadipika, A. D. 1794.
Contents: the text occupies the centre of each page,
the commentary the top and bottom.
Measurement of binding: 157X 10 in.
No. of leaves: 215 = i +480+ i blank ; 216=1 + 583
+ i blank. The original foliation numbers each skandha
severally, having (215) 77 + 43+1184-97 + 83 + 62 +
(216) 57 + 45 + 48+ 143+ (128+ 129)+ 32 leaves.
Bate:
(1) 215, f. 77 v : srisamvat 1850 (= a. d. 1794)1
(2) 216, f. 120: samvat saptarsa 69 (=a. d.
1 793 -1 794) l
(3) 216, f. 293: samvat 1747 (is it saptarsa, i. e.
= a. n. 1771-1772 '0 I Perhaps however this reading
is simply a slip for 1847, since if it is saptarsa, the
hundreds if given would be 47.
Scribe : 215, f. 120: likhyatam pam Kalabhavdneda-
sena l It is correctly spelt °ddsena in 215, ff. 238,
418 V ; 216, ff. 293 v , 422 v .
813, 814— MS. Fraser 1
Matsya Purana, 17th cent.?
Contents: see on 95. The text is bounded on
cither side by two double black lines. The leaf of
the archetype has in the centre the usual Jaina space.
Measurement of binding: 1 ij x 6 in. approximately
for each volume.
No. of leaves : vol. I = ii + 301 + ii blank ; vol. II =
ii, 302-601, ii blank. The original foliation also has 601
leaves, but f. 505 is lost, and f. 150 of the archetype
is bound in (see f. 1).
Character: Jaina Devanagarl.
SANSKRIT MSS.
815 —MS. Fraser 15
Dvarakamahatmya, A. D. 1456.
Contents: see on MS. Sansk. e. 28 (1171) and on
124. The text is bounded on either, side by two red
lines. A good many corrections have been made by
a later hand. —
Measurement of binding : 9* x 5 in.
No. of leaves: iii + 96 + iii blank. The original
foliation makes 117, but ff. 1-5, 17-24, 35-41, 43,
68, 71 are missing, and two ff. (numbers obliterated)
are double.
Bate: f. 96: svasti samvat 1513 varse sake 1378
(=a.d. 1456) pravarttamdne daksindyane varsdrtau
srdvanamdse suklapakse pamcamydm tithau budhadine l
Scribe : f. 96 : mahdrdjddhirdja (two or three aksaras
lost) suratanakrtapadinardjye Rdnapuradurgavdstavya 1
bhinrvdl (?) otpannasrbndlajndtiyapamcaratnaadhyana
(five or six aksaras lost) ndbhirata Sidvdsudevagunayrd-
macakravd \ updlani alavdsutakdhndkena likhitam \ dtma
(rest lost) 1 The prince is Qutbu-d-Dln of Gujarat.
816 -MS. Fraser 40
Dvarakamahatmya, 18th cent.?
Contents: f. 8 is apparently part of another MS.
It is quite out of place in its context.
Measurement of binding: 1 i-i- X 5j in.
No. of leaves : ii + 86 + ii blank. Originally only 85,
as the leaf after f. 7 does not belong to the MS.
Bate: probably about 1800-1820 a. d. Hardly
any older.
817 —MS. Fraser 17
Prabhasaksetratirthayatranukrama, A. D. 1478.
Contents : the text is bounded on either side by
two black lines. There are many lacunae marked,
especially towards the end.
Measurement of binding: io|x5| in.
No. of leaves : ii + 54 + ii blank.
Bate: the exact date is Tuesday, July 15, a. d. 1477,
Kielhorn, Ind. Ant., XVIII, 252. The prince is
Mahmud Shah of Gujarat.
818— MS. Wilson 532
Nilamata, A. D. 1824.
Contents : see Buhler, Kasmlr Report, pp. 38 sq.
The proper name of the work is Kasmlramahatmya,
according to Nilamata (or rather Nila), Bhandarkar,
Report, 1883, 1884, p. 44. This MS. is of some im¬
portance as it is apparently independent of Sahebram’s
recension ; e.g. alter verse 5 11 it has prabhah 1 Vai -
syampdyana/i \ Narako ndma nrpati Vasudevam svayam-
APPENDIX TO VOL. I (810-823)
103
vare I jagdma Mathavo yuddlium caturamgabal&nvita/i II
tcitra tasyabhavad yuddham Vasudevena dhimatd l ya-
drsam Vasudevasya Narakena sahabhavat II tatah ca
Vasudevena sa yuddhe vinipatitah l This will explain
Biihler’s remark, p. lvi, note. It is a fairly accurate MS.
The Nilamata is quoted in Rajatarangini, I, 14. As
it mentions Buddha as an incarnation of Visnu, it
cannot well be earlier than the 6th or 7th cent. a. d.,
Biihler, p. 41, note. Cf. Biihler, Ind. Ant., XVIII,
184, XIX, 410; Eggeling, India Office catal., p. 1398,
whose MSS., it may be noted, belong to the recension
of Sahebram; Stein, Rajatarangini, II, 376-378.
Measurement of binding: 9^ X jf in.
No. of leaves: v + 79 (really 81, as f. 47 is triple) +
vii blank. In the original foliation there are 79, but
two blank leaves (47b, 47c) are not counted. Arranged
like a European book.
Bate : f. 79^: samvat 1880 ( = a. d. 1824) dsadhavati
astamyam likhitam bhattaharakena 1 For °vati cf. suti,
Bendall, Brit. Mus. catal., p. 31; Biihler, Palaeo-
graphie, p. 86.
Character: some traces of the style of Kasmiri
Nagari.
819—MS. Wilson 530
Mayurafiataka, 18th cent. P
Contents: see on MS. Sansk. c. 31 (1257). The
text is bounded on either side by a dark red line
over two light red lines. Verses 7 01-103 give the
facts of Aufrecht’s third paragraph.
Measurement of binding : 9j x in.
No. of leaves : iii + 20 + iii blank.
820 —MS. Fraser 9
Krsnakridita, 15th cent. ?
Contents : this Kesavarka must be distinguished from
the author of the Jatakapaddhati (704), who probably
wrote the Vivahavrndavana (791). The only other
MSS. as yet known are likewise very imperfect, Bhan-
darkar, Report, 1884-1887, p. 49, nos. 339, 340.
The following are the numbers of the leaves re¬
maining: 1, 3, 4, 5-8, seven unnumbered, 54, 55-81,
157-164, two unnumbered, 168-206, 283—298, half of
299, 300-306, 308-310, 314-316, 318, one not num¬
bered, 322-325.
The MS. has been written in two different styles:
(1) in ff. 1-43 of the new foliation (1—81 of the old)
there is in the centre of each leaf the usual Jaina
figure with a small hole pierced in the centre ; (2) in
ff. 44 to the end there is a square or oblong blank
space in the centre. Both styles are of the same date.
The text is bounded on either side by two double
red lines. -
Measurement of binding : 11x5^ in.
No. of leaves : ii + 118 + ii blank.
Character: Jaina Devanagari.
Injuries: many of the leaves are badly torn and
have been covered with transparent paper.
821— MS. Mill 145
Nagananda, 19th cent.?
Contents: printed often in India; w ith notes by
Brahme and Paranjape, Poona, 1893 ; translated by
Boyd, London, 1872 ; cf. Schuyler, Bibliography of the
Plays attributed to Harsadeva, Leiden, 1903. Cowell,
in the preface to Boyd’s translation, pointed out that
Harsa was the prince of Thanesar (about a. d. 607—
648). Who was the real author it is difficult to say;
it has been attributed to Bana, Dhavaka, Harsa by
different scholars; cf. Ldvi, Theatre ind., pp. 185,
190 sq.; Schroder, Ind. Lit., pp. 644, 645. At any
rate it is long anterior to the author of the Naisadhiya.
Former owner: f. iii, in Mill’s hand : c Sent me by
W. H. Watts, Esq., Bombay, Jan 1, 1838.’
Measurement of binding: 8| x 6-J in.
No. of leaves: ii + 36 + ii blank. In the original folia¬
tion 18 + 18 leaves. Arranged like a European book.
822— Ms. Fraser 10
Prabodhacandrodaya, 15th cent.?
Contents: see on 280. The MS. is bounded on
either side by two black lines. The text looks later
than the Hindi version. Cf. Vrajavasi’s Hindi transla¬
tion, Lucknow, 1875.
Measurement of binding : 9! x 6j in.
No. of leaves: iii + 130 +iii blank. The text had
47 ff., but f. 5 is lost. The version has 1—13 (really
12, f. 7 missing), 14-34, 36-59, 61-87 leaves.
Character: of the Hindi version, Jaina Devanagari.
Injuries : half of f. 114 is lost. There are holes in
ff. 59, 60.
823— MS. Fraser 23
Kasikavrtti, 10th cent.?
Contents: after Biihler’s discovery that the Kasika
was a Kasmirian work, Report, p. 72, Peterson, Report,
1882, 1883, p. 29, and Bhandarkar, Report, 1883, 1884,
p. 57, made it probable that Vamana composed the last
three adhyayas, and so Biihler, Ind. Ant., XVIII, 189.
Stein, however, Kasmir catal., pp. xviii-xx, on the
104
CATALOGUE OF
evidence of a modern MS. (a. d. 1852), seeks to show
that Vamana is only the author of VI, 3 to VIII, and
that Jayaditya or Jayanta was father of Abhinanda,
and a contemporary of Vamana under Jayjipkla (a. d.
^-2-783). But this ignores I-tsing’s decisive evidence
which fixes Jayaditya’s date in a. d. 660, Max Muller,
India , p. 345, and, as to Vamana, Liebich, Pdnini , p. 11,
points out that the book known to I-tsing consisted of
18,000 slokas, and so must have contained the whole
of our modern text, which is about 15,000 slokas in
extent. Bhandarkar, 1 . c., thinks Vamana was much
later than Jayaditya, but of this there is no evidence,
and Keith, J.R.A.S., 1901, p. 580, has shown reason
to the contrary. Cf. on MS. Sansk. e. 9 (893 (2)).
Measurement of binding: 1if x 5^- in.
No. of leaves : ii + 38 + ii blank.
824— MS. Walker 217
PrakriyakaumudI, A. D. 1577.
Contents : from the Prakriyakaumudiprasada of the
author’s grandson, Vitthalacarya, Bhandarkar, Report,
1883, 1884, pp. 58, 59, has determined llama’s date as
about a. d. 1450. Cf. on MS. Sansk. d. 96 (1120).
This MS. is very accurate: the sutras are distin¬
guished from the commentary by being touched over
with red pigment. As ff. ic>5 v , 183V, being the last
leaves of their parts, are somewhat rubbed, two modern
leaves, ff. 105'’, 183b, have been inserted, containing
a correct copy of the parts affected. On f. 106 is
some scribbling. F. 15 is entirely new. A later hand
has made a few corrections.
In both cases the text is bounded on either side by
two black lines. ——.
Bought from Benares in 1861. It is not a Walker MS.
Measurement of binding : 10-j X 5-7 in.
No. of leaves: ii+183 (really 185, as ff. 105, 183
are double) +ii blank. The original foliation has 105 +
78 leaves.
Late: f. i 83 v : sake 1499 ( = a.d. 1577) nvarand-
masamvatsare \
Scribe: f. i 83 v : Vithalabhattalasobhanyana likhitam
sampurmrn 1
Injuries : f. 15 is lost: ff. 1, 2, 125, 181 are mended.
825—MS. Fraser 18
PrakriyakaumudI, 15th cent.?
Contents : the text is bounded on either side by
two black lines. ■■
Measurement of binding : 9^ x 5^ in.
No. of leaves : ii + t 50 + ii blank. The original folia¬
tion counts 152, but ff. 46, 60 are lost.
SANSKRIT MSS.
826— MS. Fraser 27
Katantrasutravrtti, A.D. 1385, 1413.
Contents : see on 374 . In part 1 the text is bounded
on either side by two red lines, and the MS. is much
corrected by a later, though old hand. There are no
corrections in part 2, but ff. 71, 72 seem not to be in
the original hand. 1
Measurement of binding : gf X 4j in.
No. of leaves : ii+ 72 (really 73, as f. 17 is double) +
ii blank. In the original foliation the leaves are num¬
bered 24-33, 39> 81-93, 95-109, 59, 60, 62-93.
Late:
(1) f. 38 v : samvat 1441 ( = a. d. 1385) varse srd-
vanasudi 2 ravau \
(2) f. 72 v : samvat 1469 ( = a. d. 1413) varse
dkhadhasudi 9 sundv I
Scribe: (2) f. 72 v : adyeha Ndradiyamahdsthdne
Lddajndtiyasrai °harldsutachocharasya pathanartham l
827— MS. Fraser 37
Bhasamanjarl, 17th cent. ?
Contents : this agrees fairly well with the MS. de¬
scribed by Taylor, Catal., I, 229.
The text is bounded on either side by two broad red
lines. ——
Measurement of binding : 9^ x 4^ in.
No. of leaves: iii + 5 + iii blank.
828— MS. Fraser 33
Elementa literaturae Devanagaricae, 18th cent.?
Contents: the MS. contains (1) the single letters,
(2) these doubled, (3) vowels added, (4) double con¬
sonants, (5) the numbers, 1-110, then the hundreds,
then ekahajara, dasahajdra, ekaluksa, dasa/dsd, ekakodi ,
dasak 0 , ekaabja, dusa 0 , ekasarba, dasa °, ekanisarba, dasa°.
F. 8 is reversed in binding. The marginal decoration
is elaborate and pretty. Fraser (?) has added transcrip¬
tions of the letters. ——
Measurement of binding : 10^ x 5- in.
No. of leaves : iii + 9 + iii blank.
Late: really about a. d. 1739, sec 802.
Scribe : f. 9 : likhitam rsirbjadharaji 1
829— MS. Fraser 24
Namalinganusasana, A.D. 1514.
Contents : see on 415, 418, and for the date Hoernle,
J.R.A.S., 1907 , pp. 413 - 417 ; Jolly, ibid., p. 174 . The
text is bounded on either side by two black lines.
Measurement of binding: io-| x 5j in.
No. of leaves : iii + 48 + iii blank. The original folia¬
tion counts 62 ff., but ff. 16, 33-39, 43-48 are lost.
Scribe : f. 48 v : for rdje read probably rau \
APPENDIX TO VOL. I (823-837)
105
830— MS. Fraser 14
Abhidhanaratnamala, A. D. 1434.
Contents: see on 421. Verses 114-128 of book I
and verses 27—41 of book IV are lost. The books end
on ff. n v , 45, 50, 56 v , 63 v .
The text is bounded on either side by two dark red
lines.
Ahmadnagar was founded in a. d. 1427, Duff,
Chronol. of India, p. 248. Can this Edala be Minin
‘Adil Khan I of Khandesh who succeeded his father in
a. d. 1437 ? The dates are doubtful, cf. Bombay
Gazetteer , I, ii, 621. ^_
Measurement of binding : 9j- X 6 in.
No. of leaves: ii + 64+ ii blank. The original folia¬
tion counts 66, but ff. 9 and 53 (not 55) are lost.
831— MS. Fraser 20
Abhidhanaratnamala, A. D. 1445.
Contents: the text is bounded on either side by
two dark red lines.
Measurement of binding: io|x 5^ in.
No. of leaves : ii + 63 + ii blank. The original folia¬
tion counts 83, but ff. 1-20 are lost.
Date: f. 63 v : the reading is margrasiravadi ^bhaume I
832— MS. Fraser 25
S'abdaratnakara, 15th cent. ?
Contents: for Mahipa’s date see on 833. After
f. 40 (original foliation), ending with verse 447 of book
II, there follows a f. 45, containing book III, 31—46.
The text is bounded on either side by two dark red
lines.
Measurement of binding : 10 X 5-| in.
No. of leaves: iv + 29 + iii blank. There were origi¬
nally more than 45 leaves, but ff. 1, 2, 6, 11, 29-36,
41-44 are lost.
833— MS. Fraser 16
Anekarthatilaka, A. D. 1443.
Contents: B was written a. d. 1374 according to
Stein, Kasmlr catal., p. 52 (racanakdlah samvat 1430).
He is quoted by S'ivarama on Vasavadatta, Aufrecht,
Catalogus Catalogorum, p. 444.
The text is bounded on either side by two black lines.
Measurement of binding : 11x5 m.
No. of leaves: iii + 45 + iii blank. The original folia¬
tion counts 46, but f. 13 is lost.
Date : f. 45 v : samvat 1499 ( = a. d. 1443) varse \
BODL. SANS. CATAL. APP.
834— MS. Fraser 13
KatnakoSa, 15 th cent. P
Contents: see the description in Peterson, Deport,
1884-1886, pp. 267-270. This MS. shows only a few
divergencies, but is imperfect, ending on f. 23 with
the caturvisatividham saury am. Is this the Ratnakosa
often cited by Rayamukuta (a. d. 1431), Aufrecht,
Z.D.M.G., XXVIII, 116? ’
The text is bounded on either side by two black lines.
In the centre of each page is a blank square space.
Measurement of binding : 9 j- X 5^ in.
No. of leaves : iii + 23 + iii blank.
Character: Jaina Devanagarl.
835— MS. Wilson 534
S'rutabodha with Subodhini, A. D. 1790.
Contents: the text is in the centre of each page, the
commentary at the top and' bottom. The whole is
bounded on either side by two red lines. There is a
lacuna on f. 4, a diagram on f. 10. The title of the
commentary should be Subodhini, Aufrecht, Flor.
catal., p. 66, Leipzig catal., p. 267 ; Mitra, Notices,
IV, 197. Cf. on 470.
Measurement of binding : iof X 6| in.
No. of leaves : i 4-10 + i blank.
Date: f. 10: samvat 1852 ( = a.d. 1796) mati vaisd-
savidi 12 dine lipikrtam Avantimadhye I The same
date is given on f. 9 V .
836, 837—mss. mui 59,00
Bhattadlpika, A. D. 1732-1734.
Contents: see Hall, Bibliog. Index, p. 179, who says
that Khanda died in samvat 1722 ( = a. d. 1666), but
according to Aufrecht, Catalogus Catalogorum, p. 411,
Bhaskararaya, author of the Bhattacandrika, a com¬
mentary on the Dipika, lived about a. d. 1629;
Winternitz, R.A.S. catal., pp. 121,172,173 ; Eggeling,
India Office catal., pp. 704 sq .; Mitra, Notices, IV,
156, VII, 271 ; Burnell, Tanjore catal., p. 83.
The text is bounded on either side by two or three
red lines.
Measurement of binding: n|-x6|-in.
No. of leaves:
59 = ii-h 213 + ii blank. The original foliation
counts 22 + 29 + 94 + 35 + 36 (really 33, as ff. 9, 18, 29
are wanting).
60 = ii+ 269 + ii blank. The original foliation
counts 45 + 21 + 20 + 64 (really 65, as f. 29 is repeated)
+ 68 (really 70, as two lodhapattras ara inserted
after f. 7) + 27 + 21 leaves.
p
106
CATALOGUE OF
Bate: only AT. 119-269 of 60 arc dated.
(1) F. 151 : samvat 1789 ( = a. d. 1733) phdlguna-
vadicaturthydm some l
(2) f. 22i v : samvat 1790 ( = a. d. 1734) rudhi-
rodgarinamasamvatsare jyesthamdsi krsnapakse dasam-
ydirn sanau I
(3) f. 269V : samvat 89 ( = A. D. 1733) P au $ e mdsi
krsnapakse sasthyam ravivare l
Scribe : all 69 seems to be by one hand except ff.
12-15, 146-180. Ff. 1-118 of 60 seem to be by another
hand. Ff. 12-15 of 60 are quite new, but ff. 159, 160
(sodhapattras) are fairly old. The oldest hand is pro¬
bably to be assigned to the beginning of the 18th cent.
The scribe of 60, ff. 119 sq., is given on
(1) f. 151 : Aydcitopdkhyaraghunathasunurdma-
camdrena navamadhydyaseso 9 lekhi l That is, the ninth
adhyaya from f. 33 in the original foliation onwards.
(2) f. 22 i v : Aydcitopdkhyaraghundtha 3 likhitam
idam sviirtham pardtham ca l So f. 269V.
On f. 146 of 50 an owner is mentioned : Vidyddharanl
pothl 1
838— MS. Wilson 535
Paramarthasara, A. D. 1833.
Contents: see Mitra, Notices , II, hi (85 verses);
Burnell, Tanjore catal ., p. 93b; Hall, Bibliog. Index,
p.105; Eggcling, Lidia Office catal., p. 841; Winternitz,
R.A.S. catal., pp. 157, 184. On f. ii is written ‘ Para-
martha Sara, Jain/ apparently a confusion. It ends:
u it sen sahavanam hi bhavatam prltaye mudd l idam
Paramarthasaram likhitva presitam maya II 1 ll i. e. to
Prof. Wilson.
Measurement of binding : 12^ x 5-j in.
No. of leaves : ii + 8 -I- i blank.
Late : f. 8 V : sam 1889 ( = a. d. 1833) I
839— MS. Fraser 3
Saptapadarthi, 17th cent.?
Contents : the author is S'ivaditya Misra, see Hall,
Bibliog. Index, p. 74; Mitra, Notices, II, 281 (dated
a. d. 1429); Eggeling, India Office catal., p. 669.
Edited, with Latin translation, by Augustus Winter,
Lipsiae, 1893; and, with Madhava SarasvatFs com¬
mentary, in the Vizianagram Sanskrit Series, Benares,
1893. Aufrecht, Leipzig catal., p. 289, points out that
he is anterior to Harsa. Cf. Bendall, Brit. Mus. catal.,
P- T 37*
The text is bounded on either side by two black lines.
F. 29'' is blank.
Measurement of binding : 1 i-g- X 5! in.
No. of leaves : iii + 8 + iii blank.
SANSKRIT MSS.
840 —MS. Fraser 6
Yogavasisthasara, 15th cent. ?
Contents: see Eggeling, India Office catal., pp.772sq.;
Mitra, Notices, II, 112-115, for the main work. This
MS., however, is wrongly described in the Bodl. catal.,
being nothing more or less than Abhinanda’s Yogava¬
sisthasara, described by Weber, Catal., I, 191-194.
It ends with verse 164 of chap. 42 ( = 43 in Weber).
From chap. 5 of Weber ( = 4 of this MS.) the two
MSS. agree very closely. In this MS. there are only
two chapters in the Vairagyaprakarana, and the chapter
on the Mumuksavyavahara begins on f. 20 thus:
vahaty evarn mahdmohavinivrttikaram ca yah 1 Rdmo
rdjlvapatrdkso tasmin rdjakumdrake 11 1 II It has 177
verses. Cf. Eggeling, p. 782. Printed at the Nirnaya
Sagara press in 1888. Cf. on MS. Sansk. c. 89 (1300).
Abhinanda’s great-great-grandfather flourished under
Muktaplda of Kasmir (about a. d. 726). The poet
was born in Kasmir, but wrote in Gauda for the
Yuvaraja Haravarsa, son of Vikramasila, see Peterson,
Subhdsitdvali, p. 97; Aufrecht, Catalogus Catalogorum,
p. 24 b; Ind. Ant., II, 102; Duff, Chronol. of India, p. 7 6.
The MS. shows three distinct styles of handwriting :
(1) ff. 1-268, 278, (2) ff. 269-277^ (3) ff. 278 v -28o v .
The text is bounded on either side by three dark
red lines. ■
Measurement of binding : 11-| X 6-| in.
No. of leaves : ii + 280 + ii blank.
Injunes : f. 1 is torn at the foot.
841 —MS. Fraser 4
Manava Dharmafiastra, 15th cent.?
Contents : cf. on MS. Sansk. d. 134 (1486). The Ma¬
nava Dharmasastra has been critically edited by Jolly,
London, 1887 ; and the commentaries of Medhatithi,
Sarvajfianarayana, Kulluka, Raghavananda, Nandana,
Ramacandra, and Govindaraja are printed in V. N.
% Mandlik’s edition, Bombay, 1886. Text translated by
Burnell, London, 1884; Biihler, S.B.E., XXY, who
assigns as the remoter limit of age the 2nd cent. b. c.
(not a. d. as misprinted on p. cxvii, see p. cxvi), and as
the nearer limit the 2nd cent. a. d. Cf. Jolly, Recht
und Sitte, pp. 13 sq. For its relation to the Mahabharata
see also Hopkins, Epic of India, pp. 17-22, who disputes
Buhleris contention that even the late epic only knew
Dharmasutras. This he proves wrong for the 13th
book, which tends to confirm the later limit of date given
by Biihler, since even the 13th book cannot date after
a.d. 200, and is probably earlier; Keith, J.R.A.S., 1907,
p. 681. ■ 1
Measurement of binding: iof-x 5^ in.
No. of leaves : ii + 119 + ii blank. There seem origi¬
nally to have been 165 ff.
APPENDIX TO VOL. I (837-851)
107
842-844 -MS. Fraser 5
Mitaksara, A. D. 1397.
Contents: cf. on MS. Sansk. e. 66 (I486). Edited,
Bombay, 1892. Yijnanesvara flourished at the court of
Yikramaditya YI, Western Calukya (a. d. 1076-1127),
see Bhandarkar, Hist, of Deccan, p. 87; Jolly, Recht
und Sitte, p. 32, and for his relation to Apararka,
J.R.A.S. , 1906, p. 936.
Yols. I and II seem to have been written by one
hand, vol. Ill by another.
The text is bounded on either side by two red or
black lines. There are occasional later corrections
throughout. ■
Measurement of binding: 11£ x 6 in. approximately
for all the three volumes.
No. of leaves: vol. I=iii + 98 + iii blank ; vol. 11 =
iii + 150 + iii blank ; vol. Ill = iii + 285 + iii blank.
Date: vol. Ill, f. 285V: samvat 1453 (= a.d. 1397)
varse pausasudi 7 saptamydm gurau I This is a probable
date for vols. I and II also.
Scribe: read bahurdalavaP l
845— MS. Fraser 11
Tithinirnayasamgraha, A.D. 1562.
Contents: see Mitra, Bikaner calal., p. 479; Hall,
Bibliog. Index , p. 187; Peterson, Report, 1886-1892,
p. 7.
The text is bounded on either side by two dark red
lines. --
Measurement of binding : 9^ x 5T in.
No. of leaves : iii + 34 + iii blank. The original folia¬
tion makes 35, but f. 27 is lost.
Date : f. 34 : samvat 1618 ( = a. d. 1562) varse jesta-
vadi 12 garau l
Scribe : f. 34: sristambhatirthavdstavyasrigaudajnd-
tiyasrivisnudattakena samastalokena prabodhanartham
lisitam idam \ But originally in the place of Visnu-
dattakena was Gautamakena. Cf. on 804-806 for a
similar instance of Visnudatta’s action.
846— MS. Fraser 28
Karttikamahima, 17th cent.?
Contents: the MS. appears to be fragmentary, and
the beginning has been added by a later hand in red ink.
At the foot of f. 1, and top of f. 2 V , additions have
been made. It ends abruptly on f. 3V ; atha dipama-
hima \ krtva kotisahasrani papdni subahuny api \ nimi-
sarddhena dipasya vilayam yamti karttike w
The text is bounded on either side by two red or
black lines. ___
Measurement of binding : 10x5^ in.
No. of leaves : iii + 3 + iii blank.
847— MS. Fraser 30
Anobhadra, A.D. 1739?
Contents: the accents are written in red ink.
Measurement of binding : ic|- x 5 in.
No. of leaves : iii + 2 + iii blank.
848— MS. Fraser 20
Astahgahrdayasamhita, A.D. 1529.
Contents: see on 741, 742, and Hoernle, Osteology ,
pp. 10-16. The text is bounded on either side by
two black lines, and has been much corrected by a
later hand, which has added various glosses.
Measurement of binding: 1x 6j in.
No. of leaves: ii +151+ii blank. In the original
foliation there were 155 leaves, but ff. 146-149 are lost.
Date:
(1) f. 1 i6 v : samvat 1585 ( = a. d. 1529) varse bhd-
drapadasuddha 10 tithau bhaumadine \
(2) f. 151 v : samvat 1585 varse bhddrapadavadi
10 bhaume l
Scribe: (2) f. 15i v : Rhambhativdstavyaudicyajnditi-
yatr 0 lauhdsutasyadhyayanaya likhitam l Cf. 851, 852,
which both seem to have been written by the same
hand as this.
849, 850— MS. Fraser 22
Siddhayoga, 16th cent.?
Contents: see on 750. Edited in the Ananddsrama
Sanskrit Series , 1894. The text is bounded on either
side by two black lines.
Measurement of binding : 1 X 6^ in. approximately
for both volumes.
No. of leaves : vol. I = ii + 141 + ii blank ; vol. II =
ii+108 + ii blank. The original foliation of vol. II
makes iii ff., but ff. 1, 2, 7 are missing.
851 —MS. Fraser 19
Rugvini^caya, A.D. 1529.
Contents: see on 745. The text, which is neatly
written, is bounded on either side by two black lines.
Measurement of binding : 111- x 5^ in.
No. of leaves : ii + 74 + ii blank. In the original
foliation there are 96, but ff. 1—23 are lost, and f. 42 is
double.
Date : f. 74 : samvat 1585 varse sd 1449 (= a. d. 1527)
pravarttamane durmukhanamni samvatsare daksinana-
gave snsurye varsartau mahd(l)mdmgalyaprade srdva-
namase krsnapakse 9 tithau sanidine \
Scribe: f. 74: ’dyeha sinmahltafe (two aksaras
obliterated) dthatavdstavyaiidicyajndtiyatr 0 lahiiasutatr 0
108
CATALOGUE OF SANSKRIT MSS.
maliidh arapathu n art ha m tathu putrapautrapathanartham
vapitate Kadudra 0 Bhdrgavajhdtlyakdhnakena li (rest
lost) i Cf. 848. The two aksaras lost were probably
khambh 0 .
052 —MS. Fraser 21
Cikitsakalikatika, A. D. 1530.
Contents : for this commentary see Weber, Catal.,
I, 293. Tisata and Candrata flourished between 1050
and 1350 a. d., as they cite Bhoja, and are cited in the
YTrasiinhaloka, Aufrecht, Flor. catal , p.121; Bhandar-
kar, Report, 1883, 1884, p. 87; Hoernle, Osteology,
p. 100, takes Bhoja as the elder (cf. Keith, J.R.A.S.,
1908, p. 524), and gives the date at 1000 a.d.
The text is bounded on either side by two black lines.
Measurement of binding : 1 iy X 6 in.
No. of leaves : iii + 118 + iii blank. The original
foliation makes T17, but f. 27 is double.
Date : f. ] 18 : samvat 1586 (= a. d. 1530) varse sake
1452 pravarttamdne daksindnakte srisurye sana (?)
(lacuna indicated) rtau kdrttikamdse suklapakse 12
tithau gurudine 1
Scribe : f. 118 : adyeha srlkhambhdyatavdstavya-
udicajndtiya \ No more has been written, but see 848,
861.
853— MS. Fraser 39
Mahabharata, Matsya Parana, &c., 16th cent.?
Contents : a. f. 3 is f. 4 of the old foliation, the
original f. 3 being lost. Extracts from the Bharata-
bhavadlpa are inserted at the top and bottom.
b. is numbered f. 3.
c. in Bengali character, a modern ritual fragment,
numbered as ff. 24, 25.
d. is numbered as ff. 1—6.
e. verse 11 runs: Raghavena munina krtam stavam
Visnurdjaprasddatah 1 dosadrsfim atihdya sddaram grah-
yam etad akhilam vicuksanai/i 11 iti Rdghave krta sri-
ganesastutih 1
f. is numbered as ff. 40, 94, and the rest is not
numbered; perhaps by a different hand.
g. begins: orn namah srlsurydya I yasmdt sarvafy
prasaratitardm jhdnakartrsvabhavau rupair bdhyair (?)
visaparacitair avrtir yasya nasti l sabddrthdbhyam vita-
tham iva yas talhdrupam vidhatte jivav ddityam tam
aham tanum cittabhastham pranaumi 111II
h. is numbered f. 122.
i. is numbered as ff. 8-12.
1 . begins : gdmbh'irydtisayena sarvajagatdn netrbni
manam gatdpatram yasya navinatdm bhajati yatpadme-
yam asij jagat \ &c.
n. is in Bengali character.
0. Rama wrote the Kundakrti in a.d. 1489. The
present work is a fragment of his Karmadipika, see
Aufrecht, Catalogus Catalogorum, p. 513^.
Measurement of binding : 14-g- X 7^ in.
No. of leaves : ii + 29 + i blank.
Dates: very various, mostly of the 16th or 17th
cent.
854—MS. Gujarati d. 1
Imagines regum Indicorum, 18th cent.?
Former shelfmark: MS. Bodl. Sanscr. 14.
Former owner : prefixed is a letter, dated London,
July 8th, 1760, from John Cleland, setting forth that
a Mogul General presented it to Tegbeg Khawn,
Governor of Surat, who gave it to Frazer, who ‘ parted
with ’ it to Cleland, who sent it to Pope, who presented
it to the Library in 1737, according to the note on the
fly-leaf signed Alex. Pope. Another account, anony¬
mous (Fraser’s ?), prefixed to the volume, says that
the ‘collection fell by great chance into an English
gentleman’s hands, at a time that Mirza Golam
Mahomet, brother to the Governour of Surat. . ., was
enquiring it out as a present to the Ghenim Generali,
who was encamped near the city with his forces.’
These notices can hardly be reconciled. For Teghbeg
Kh an see Bombay Gazetteer, I, i, 313 sq.; and for the
portraits of the Moguls, Manucci’s collection, Storia do
Mogor, translated by Irvine, I, Iii sq.
INDEX
[Authors and their Relatives.
Scribes and their Relatives and Patrons.
Former Owners.
Works.
Historical Names.
Places.]
Agni Purana, 42.
Agnivesa, Ramacandracaritrasara,
213.
Anganabhidhapura, 203.
Angarejacandrika, by Vinayaka-
bhatta, 240.
*Acalabhaji ( 1 ), 403.
Ajayapala, Nanarthasamgraha,427.
Ajhanabodhinl (1), by S'ankaracar-
ya, 548.
Aiijunapura, 240.
Advaitaratnaraksana, by Madhu-
sudana Sarasvati, 555.
Adhyatmaramayana, from Brah-
manda Purana, 72-74.
Ramagita, from, 731.
Anangaranga, by Kalyanamalla,
518, 519.
tAnanta, 355, 46.
Anautadeva (a. d. 1061-1083), of Kas-
mlr, 321-324.
Anantadeva, Vyavaharadidhiti,
045.
Anargharaghava, by Murari, 203-
200 .
Commentary on, by Rucipati,
287.
Commentary on, 208.
Anubhutiavarupa, Saraavatlsutra*
vrtti, 382-384.
Anumanacintamani, by Gangeaa,
585, 680.
Commentary on, by Raghunatha,
587-589.
Super-commentary on, by Jaga-
disa, 593-590.
Commentary on, by Mathura-
natha, 590-592.
Commentary on, by Bhavananda,
697.
Commentary on, 598 (frag.).
AnumanatippanI, by Mathura-
natha, 590-592.
Anumanadidhiti, by Raghunatha,
687-689.
Anumanamanididhititippani, by
Jagadlsa, 593-590.
Anusmrti Vaisnavi, 33, 34.
Anekarthatilaka, by Mahipa, 833.
Anekarthasamgraha, 454.
Anekarthasamuccaya, by S'asvata,
414.
Annambhatta, Tarkasamgraha,
005.'
Tarkasamgrahadipika, 005.
Ajpardrka, relation to Vijnanesvara,
842-844.
Aparoksanubhava, see the following.
Aparoksanubhutisudharnava, by
S'ahkaracarya, 644, 545.
Appayyadiksita, Kuvalayananda,
505.
Abhijnana 6 akuntala, by Kalidasa,
251-253.
Commentary on, by S'ankara,
254.
Abhijndnaidkuntalafikd , by Rdmandtha,
218.
Abhidhanacintamani, by Hema-
candra, 422-420.
Abhidhanatantra, by Jatadhara,
434.
Abhidhanaratnamala, by Hala-
yudha, 421, 830, 831.
Abhinanda, 823, 104 .
Abhinanda, Yogavasisthasara, 840.
Abhinavakalidasa, Samksepasan-
karajaya, 020 .
Abhinavagupta, Paramarthasara,
675.
Abhiramamaninataka, by Sundara,
209, 270.
Amadavada, 051, 052, 82, 790.
Amaracandra, Balabharata, 37.
Amarasimha, N amalihganusasana,
410-420, 829.
Amrtananda, 149.
Ambikakhanda, old MS. of, 120-122.
Arisimha, Kdvyakatyalatd, 497.
Argalastotra, 174.
ArjunamiSra, Bharatarthadlpika,
14, 15.
Alamkarakaustubha, by Karna-
pura, 492-494.
Commentary on, by Lokanatha
Cakravartin, 492, 493(?), 494.
AlamkaravimarsinI, by Jagadratha,
495, 490.
Alamkarasarvasva, by Ruyyaka,
495, 490.
Commentary on, by Jagadratha,
495, 490.
Alava, 815, see fKahnaka.
Alphabet, 828.
Allata, Kavyaprakasa, 500-504.
Avataravadavali, by Purusottama,
94.
Avanti, 835.
Aiviriikumara, 768.
Astangahrdayasamhita, by Vag-
bhata, 741, 742,* 851.
Astddhydyl, by Pdnini, 342-373, see
Mahabhasya.
Astavakrasamhita, 558.
Asalatiprakasa, 444.
Ahamtnadavada, 209, see also Amada¬
vada.
Ahobala, Mahimnahstavatika, 237.
Akhyatavadavivecana, 010.
Atahkadarpana, by Vacaspati,
740.
Atmatattvaviveka, by Udayana, 002.
Commentary on, by Raghunatha,
002 .
Atmatvajativicara, by Mahadeva,
_ 608 '
Atmaprakaia, by S'ridharasvamin,
111 .
Atmabodha, by S'ahkaracarya, 540,
547.
Commentary on, by Madhusu-
dana Sarasvati (?), 540, 547.
Atmabodhavrtti, 548.
Atmarama, see Svatmarama.
Adityahrdayastotramantra, 727.
Adhanapaddhati, from Karmadi-
_ pika, by Rama, 853.
Ananda, recension of Madhavanala-
_ khyana, 340.
Anandakanda, from Bhairavatantra,
_ 759.
Anandagiri, S'ankaravijaya attri¬
buted to, 024, 026, and see Anan-
datirtha.
Anandatlrtlia, Tripu rlprakarana vrtti,
649.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
Order of alphabeta, a, i, I, u, u, r, r, J: e,ai,o,au: k, k-h, g, g-h, n: c, c-h, j, j-h, n: t, t-h, d, cl-h, n: t, t-h, d, d-h, n: p, p-h, b, b-h, m:
y, r, 1, v: s, s, s, h: J (h), • m (m).
References are made thus823 (2), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
110
Anandalahari, by S'ahkaracarya,
168-172.
Commentary on, by Kaivalya-
srama, 168.
Commentary on, by Gaurikanta
Sarvabhauma, 169.
Commentary on, by Krsnacarya,
170.
Anandalaharistotra, by S'ankara¬
carya, 226.
Anandavardhana, cites Magha, 103,
and Kumarasambhava, 190.
Anobhadra, 847.
Apaduddharakabatukabhairava-
stotraraja, 729.
Apadeva, MImamsanyayaprakasa,
524.
Apajibhatta, father of BhaskaraSar-
man, 466, 58 .
Aryabhata, Aryasiddhanta, 769-
771.
Aryasiddhanta, by Aryabhata, 769-
771.
Alamandarastotra, by Yamunacar-
ya, 227.
Asvamedhikaparvan, by Jaimini,
31, 32.
Ahnikatattva, by Raghunandana,
671, 672.
Index to the Puranas, 142.
Index to Lexica, 456.
Imagines regum Indicorum, 854.
Irugapa Dandadhinatha, Nanar-
tharatnamala, 441-443.
Isvarakrsna, Samkhyakarika, 569.
Uttarapaksavada, 598.
tUttararfuna (a. n. 1802 ), 651, 652,
82 ; father of 1 Farusurania (a. n.
1800 V 790.
Uttararamaearita, by Bhavabhuti,
261.
Commentary on, by Narayana,
262.
Udayana (for date, cf. J.R.A.S., 1908 ,
pp. 522 - 526 ), Kusumanjali, 599-
601.
Atmatattvaviveka, 602.
Uddharanadeva (a. d. 1350 ), Tomara
prince, 98.
1’d.blmta, used in Pancatantra, 335.
Uvata, Commentary on Rudrajapya,
724.
Urdhvamnayasamhita, attributed to
Narada, 735.
Rtusamhara, by Kalidasa, 217.
Ekaksarako£a, by Purusottama,431,
432.
INDEX
Ekadasitattva, by Raghunandana,
673.
Ekavall, commentary on, by Mallina-
tha, 180, 181.
Elementa literaturae Devanaga-
ricae, 828.
*Ouselcy (Sir F. A. Gore), former owner
of MSS. Ouseley.
*Oyilsen, 642, see also *‘\Vilson.
Kamsavadha, by S'esakrsna, 271.
Kadudra or Katupadra, 851, 108 .
Katharnava, by S'ivadasa, 328.
Kathasaritsagara, by Somadeva,
321-325.
Kapilasamhita, from Skanda Pu-
rana, 131.
Kamalakara, father of Kesavarka, 791.
Kamalakara (a.d. 1612 ), S'udradhar-
matattva, 654.
Kampa, father of Saiigama II, of Vija-
yanagara, 372.
Karana, of Cedi, 286.
Karanakutuhala, by Bhaskara, 774.
Karnapura, Alamkarakaustubha,
492-494.
Karmavipaka, from S'atatapasmrti,
641.
Karmavipaka, by S'ankara, 659.
Kalakattii, 257.
Kalaghutti, 669.
*Kalabhavancdasa (a.d. 1794 ), 811,
812.
Kaladhara, Kavyaprakasiyakari-
kavali, 501.
Kalkita, 257.
Kalpadru, by Kesava, 433.
Kalyana (a. d. 1632 ), of Iladurga, 228.
Kalyana, Gitagangadhara, 233.
Kalyanamalla, Anahgarahga, 518,
519. ‘
Kalyanamalla, patron of Bharatasena,
198.
Malati Meghadutatika, 218.
Kalyanarajaprasasti, by Madana,
228.’
Kallindtha (a.d. 1430 ), 476.
Kalhana, Rajatarahgim, 314-316.
Kavikalpadruma,by Vopadeva, 397.
Commentary on, by Vopadeva,
398.
Kavikalpalata, by Devendra, 498.
Kavicandra, Kavyacandrika, 499.
Kaviraja, Raghavapandaviya, 212 .
KasmTra, 22.
Kamhajit Vadava, father of Mahadeva,
790.
Kakarudrasamvada, 795.
Kancana, Dhanamjayavijaya, 279,
280.
Katantra, by S'arvavarman, 374.
Commentary on, by Durgasimha,
375, 376.
Super-commentary on, by Trilo-
canadasa, 377.
Katyayanimahatmya, from Skanda
Purana, 110.
Kadambari, by Bana and Bhusana-
bhatta, 334.
Kainadevu, father of Hemadri, 709.
Kamadeva, Prayascittapaddhati,
709.
Kivniasiitra , by VaUyayana , 617.
Commentary on, by Bhaskara,
517.
Kamesa, Maithila king, 718.
*Kamnaji, 426.
Karakavada, by Rudra, 818.
Karttikamahima, 846.
Karttikamahatmya, from Padma
Purana, 59.
1 . Kalajnana, by Malladeva, 749.
2 . Kalajnana, by S'ambhunatha,
753.
Kalanirnaya, by Madhava, 642.
Kalamadhavxya, 642.
Kalika Purana, 132.
Kalidasa, Abhijnanasakuntala, 251-
254.
Rtusamhara, 217.
Kumarasambhava, 184-101.
Malavikagnimitra, 256, 257.
Meghaduta, 218.
RaghuvamSa, 175-184.
Vikramorva&l, 255.
S'rutabodha, 470.
Kavyakalpalatd, by Arisimha, 497.
Commentary on, by Amaracan-
dra, 497.
Super-commentary on, 487.
Kavyakalpalata vrttiparimala, 497.
Kavyakamadhenu, by Vopadeva,
398.
1 . Kavyacandrika, by Kavicandra,
499.
2 . Kavyacandrika, by Nyayavagisa,
499.
Kavyaprakasa, by Mammata and
Allata, 500, 60i.
Commentary on, by Govinda,
502, 503.
‘Super-commentary on, 504.
Kavyaprakasiyakarikavali, by Kala¬
dhara, 501.
Kavyapradipa, by Govinda, 5C2,
603.
Commentary on, 504.
Kavyadarsa, by Dandin, 485,
486.
Commentary on, by Harinatha,
485.
Thick type — Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabet: - a, a, i, i, u, u, r, r, 1: e, ai, o, au: k, k-h, g, g-h, h: c, c-h, j, j-h, n: t, t-h, d-h, n: t, t-li, d, d-h, n: p, p-h, b, b h, m :
y, r, 1, v : s, s, s, li: ; (h), • m (iii).
Referencee are made thus :-823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
INDEX
111
Kavyalamkaravrtti, by Vamana,
487.
Commentary on, by MaheSvara,
487.
Kaiikatilaka, by Nilakantha, 229.
Commentary on, by Bhudeva,
229.
Kasikavrtti, by Jayaditya and Va¬
mana, 823.
KasT, 79-81, n, 102, 110, 120, 311,
367, 480, 617, 789.
Kasikhanda, from Skanda Purana,
120 - 122 '.
fKasInathadevasarman (a. d. 1827),
390-392.
tKasinatha Somana (a. d. 1734), 200,
26.
Kaiimahatmya, from Brahmavai-
varta Purana, 70.
Kaiirama, ChandogaiSraddhatattva-
tika, 706.
Tithitattvatika, 682.
Malamasatattvatika, 694.
Kastha, 661, 662.
tKasinatha (a. d. 1821), 229, 30.
tKahnaka (a. d. 1529), 848, 861,
862.
tKahnaka (a. d. 1456), son of Alava,
816.
Hinduvilva, 221.
Kiranavall, by Dadabhai, 772.
Kiratarjunlya, by B/iaravi, 192.
Commentary on, by Mallinatha,
192.
Kirtivarman, Candella prince, 280.
Kilaka, 174.
tKumvarajl, puroliita, 130.
Kuttanlmata , cites Vrksayurveda,
708.
Kududra (or Kadudra or Katupadra),
851, 108.
Kundamandapasiddhi, by Vitthala-
diksita, 798.
*Kuberaji (a. d. 1798), son of Venlrama,
20 .
*Kubera Simha, 730.
Kumarapala (a. d. 1088-1172), prince,
270.
Kuma/rasvamin , son of Mallinatha,
180, 181.
Kularnava Tantra, 147.
Kuvalayananda, by Appayyadlksi-
ta, 605.
Kusumanjali, by Udayana, 699,
600.
Commentary on, by Ramabhadra
Sarvabhauma, 001.
Commentary on, by Haridasa,
000 .
Eurma Purana, 43-46.
Krkalasadipika, 148.
Krtapadina (= Qufcbu-d-Dln of Guja¬
rat), 815.
Krtyatattva, by Raghunandana, 674.
Krp£ramakuaraka, 768.
Krsnakarnamrta, by Bilvamangala,
230.
Commentary on, by Vrndavana-
dasa (?), 230.
Commentary on, 231.
Krsnakridita, Kesavarka, 820.
Commentary on, by KeSaVarka,
820.
Krsnacandra, father of tDayiicandra
(a.d, 1821), 789.
tKrsnadeva (a.d. 1730), son of Pandya-
purusottama, 286.
Krsnamitra, Manjusakuncika, 404.
KrsnamiSra, Prabodhacandrodaya,
286-288, 822.
*Krsnarama, 384.
Krsnacarya, Manjubhasini, 170.
Krsnananda, Tantrasara, 149.
tKesava (a. d. 1781 ?), 233.
Kesava, father of +Raghu(?), 579, 73.
KeSava, Kalpadru, 433.
Ke&ava , Jatcikapaddhati, 794; see also
2. KeSavarka.
Keiava, Tarkabhdsd, 606, 607.
Ke6avami6ra, Dvaitaparisista, 650.
1. Kesavarka, Krsnakridita, 820.
Padarthadipika, 820.
2. Kesavarka, Vivahavrndavana,
791.
Kaiyata, Mahabhasyapradipa, 342-
351.
KaivalyaSrama, Anandalaharitika,
108.
Kondabhatta, Vaiyakaranabhusa-
nasara, 402.
Kausalyadasa, 22, 164.
Kramadisvara, Samksiptasara,388-
393.
Kriyayogasara, from Padma Pu¬
rana, 56.
Kridakhanda, from GaneSa Purana,
134.
Ksemakarna, Ragamala, 481, 482.
Ksemendra (a.d. 1020), 321-324.
Khanda, Bhattadipika, 836, 837.
Khandanakhandakhadya, by Harsa,
62o!
Khan^aprasasti, 232.
Commentary on, by Jfianananda,
232.
tKhandenyaphulamvarlphara (?) (a. d.
1 749), 47, 7-
Khambhati, 848.
Khambhayata, 852.
Khetakasiddhi , by Dinakara, 776.
Gangatatldasasumera, 367.
fGarigadasa (a.d. 1542 ), 622.
Gangadasa, Chandomanjari, 468,
409.
Gahgadharapura, 501.
Gangavakyavali, by Vidyapati, 708.
Gangesa, Tattvacintamani, 584-
598.
Gajendramoksana, 35, 36.
Gananatha, father of Bhanudatta,
606.
Ganapatistotrani, 730.
Ganesa, Ciccandrika, 280.
Gane6a, Nalodayadipika, 219, 220.
Ganein Daivcijna , 820.
Gane£a Purana—
Upasanakhanda, 133.
Krldakhanda, 134.
Gane£asahasranaman, 135.
Gane&abhujahga, attributed to S'an-
karacarya, 730.
tGanesamisra (a.d. 1762), 304, 47.
Gane£asahasranaman, from Ganesa
Purana, 135.
Ganesastavaraja, from Bhavisya
Purana, 78.
GaneSastuti, by Raghava, 853.
Gadasimha, Nanarthadhvanimanjari
attributed to, 445.
Gayamahatmya, fromVayu Purana,
117, 118.
Garuda Narayana (a.d. 1520), 648.
Garuda Purana, 40.
Gargrgrama ( 1 ), 579, 73.
Gayatribhasya, 722.
Gayatrimantra, 160.
tGiridhara (a.d. 1697), 108.
Girinarfiyanajfiatlya, 25.
Gitagangadhara, by Kalyana, 233.
Gitagirisa, by Rama, 234.
Gitagovinda, by Jayadeva, 221-225.
Commentary on, by Narayana,
221 , 222 .
Commentary on, 223.
Gujata, 790.
Gunacandra, Vibhramasutravrtti,
380.
GunaratnakoSastotra, by Parasara-
bhatta, 235.
Commentary on, 235.
Gunakara(cf. Hoernle, Osteology , p. 17),
Yogaratnamalalaghuvivrti, 704.
Gunadhya (for date cf. J.K.A.S., 1906,
pp. 689 sq.), 321-324.
Gurugita, from Skanda Purana,
123.
Gokulanatha, Padavakyaratnaka-
ra, 619.
Gojyotisyahotribhatta (?), father of
scribe (a.d. 1741), 609.
Gopala (a.d. 1428), Rasamanjarltlkd^
607.
Thiek type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabet:—a, a, i, I,u, u, r, r, J: e, ai, o, au: k, k-h, g, g-h,n: c, c-h,j, j-h,n: $, t-h, d, cl-h, n: t, t-h, d, dh, n: p, p-h,b, b-h, m:
y, r, 1, v: s, s, h: ; (h), * m (m).
References are made thus823 (2), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
112
INDEX
tGo(pala) (a.d. 1812 ), Hanumanagiri,
71.
Goyicandra, Samksiptasaratika,
389-393.
Goraksasataka, 667.
*Govanulyarama, 384.
Govardhana, 211.
Govardhanadhariraja, patron of
S'esakrsna, 271.
tGovardhanamisra (a. I). 1762 ), 125.
Govinda, Kavyapradipa, 602-504.
Govindardja , cited in Smrtyartha-
sara, 670.
*Govindarama, 128.
Govinda Sastrin, friend of Mill, 723.
Govindananda, Tattvarthakaumu-
di, 661.
Danakaumudi, 643.
S'uddhikaumudi, 644.
Govindananda, Bhasyaratnapra-
bha, 534, 535.
Gaudajnatlya, 845.
Gautama, Nyayasutra, 576.
fGautamaka, 845.
Gaurikanta (?), Tarkabhasavrtti,
607.
Gaurikanta Sarvabhauma, Anan-
dalaharitari, 169.
Grahayajnatattva, by Raghunan-
dana, 675.
Ghantapatha, by Mallinatha, 192.
+Ghanasyama Tripathin (a. d. 1782 ),
1-13, 2 .
Cakrapanidatta (date a. d. 1060 ,
J.R.A.S., 1906 , p. 308 ), S'abda-
candrika, 453.
Candikamahatyma, from Markan-
deya Purana, 98-100.
Commentary on, by S'antanu, 98.
Caturbhuja, 14, 15.
Candrakala, by Vopadeva, 756, 757.
Candrata, Cikitsakalikatika, 852.
Candrasekhara, Madhuraniruddha,
290.
tCandrasekharadevasarman (a.d. 1832 ),
690.
Candrasimha, prince, 708.
Candrarki, by Dinakara, 775.
Candraloka, by Jayadeva, 505.
Candravati, 370, 48 .
Cciraka, 738, 739.
(Titigrama, 434.
Canakya, Rajanitisastra attributed
to, 238.
Cikitsdkalikd, by Tisata, 852.
Commentary on,by Candrata,852.
Cikitsakalikatika, by Candrata, 852.
Citrayaj nanataka, by Vaidyanatha,
272 .
Citsukfui, Pratyaktatlvadijnka, 615.
Cidasthimala, by Vaidyanatha Pa-
yagunde, 366.
Cinnabhatta, Tarkabhasapraka-
sika, 606.
Caitanya (a. d. 1486 - 1527 ), contem¬
porary of Raghunandana, 672.
Cauppamblia, 102.
*Cleland (J.), 854.
Chandogasraddhatattva, by Raghu¬
nandana, 703, 704.
Commentary on, by Kasirama,
705.
Chandomanjari, by Gangadasa,468,
469.
Chalari Nrsimha (a.d. 1682 ), Smr-
tyarthasagara, 669.
*Chochara (a. d. 1413 ), 826.
J agaccandrika, by Bhattotpala, 780.
Jagadisa, Anumanamanididhiti-
tippani, 593-596.
Jagadisvara, Hasyarnava, 311, 312.
Jagaddhara, Commentaries on—
Malatimadhava, 259.
Vasavadatta, 333.
Venisamhara, 309.
Jagadratha, Alamkaravimarsim,
495, 496.
Jagannatha, Bhaminivilasa, 236.
Jagannatha, Rekhaganita, 797.
Jagannatha, Vivadabhangarnava,
719.
tJagcinnathadevasarman (a.d. 1795 ),
697, probably identical with the
following.
tJagannathasarman (a. d. 1812 ), 681,
714.
Jajalapura, 543.
Jatadhara, Abhidhanatantra, 434.
Janardana, Bhavarthadxpika, 465.
Jambhaladatta, recension of Vetala-
pancavimsati, 327.
Jayacandra, of Kanauj, 200 .
Jayadeva, Gitagovinda, 221-225.
Jayadeva, Prasannaraghava, 289.
*Jayarama, son of Vyabhaia, 804-806.
Jayarama, Nyayasiddhantamala,
582.
Jayasimba (a. d. 1093 - 1143 ), of Anhil-
vad, 509.
Jaya, patroness of Vacaspatimisra,
648.
Jayaditya, Kasikavrtti, 823.
Jayaplda (a.d. 752 - 783 ), of KasmTr,
823, 104 .
*Jayabhattagosvarnin, 520, 523.
Jala^ayotsargatattva, by Raghu¬
nandana, 676.
Jatakapaddhatyudaharana, by
Visvanatha, 794.
Janakinatha Bhattacaryacudama-
ni, Nyayasiddhantamanjari, 581.
Janakisahasranamastotra, from Sid-
dhesvara Tantra, 162.
+Jani (i. e. Yajnrka) NanabhaT (a.d.
1802 ), 426.
*Jarana (or Jamnak 1 1), 225, 227, 242.
Jambavalivijaya, authorship of, 342-
351, 45-
Jalandharopakhyana, from Padma
Purana, 807.
Javaragrama, 747.
Jinadatta, teacher of Amaracandra, 37.
dinendrabuddld, Nyasa, date of, 377.
JImutavahana, date of, 660, 83 .
Dayabhaga, 714, 715.
Jivanatha, Svaratattvodaya, 793.
tJlvarama (a.d. 1796 ), 505.
Jumaranandin, Rasavati, 393.
Jaitrapala, of Devagiri, 471.
Jainatarahgini, by S'rivara, 314.
Jaimini, Asvamedhikaparvan, 31,
32.
Jaimini, Nyayasutra, 520-532, 836,
837.
Jaiminiyanyayamalavistara, by Ma-
dhava, 528-532.
Jonaraja, Rajatarangini, 315.
tJosikevalarama (a.d. 1798 ), 25.
Jnanendra Sarasvatx, Tattvabodhi-
ni, 360-363.
Jyotirisvara, Dhurtasamagama, 281.
Jyotisaratnamala, by S'ripati, 782.
Jyotistattva, by Raghunandana,
677.
Todarananda, cites Rasara1 7 iapradijoa,
762, and see Todarakdti^ati.
Damaru Tantra, 729.
Dallana (cf. Hocrnle, Osteology , p.i 6 ),
Nibandhasamgraha, 740.
Tandanakula, 271.
Tattvacintamani, by Gahgesa, 584,
and see Anumanacintamani.
Tattvabodhini, by Jnanendra Sara-
svati, 360-363.
Tattvarthakaumudi, by Govinda¬
nanda, 661.
Tantravarttika, by Kumarilasva-
min, 520, 522.
Commentary on, by Somesvara,
522.
Tantrasara, by Krsnananda, 149.
Tapapaksa, 209.
Tarkabhdsd, by Keiavn , 606, 607.
Commentary on, by Cinnabhatta,
606.
Commentary on, by Gauri¬
kanta (?), 607.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. 1 = a scribe. * = an owner.
Order of alphabeta, 5, i, I, u, u, r, r, 1: c, ai, 0 , au: k, k-h, c, g-h, h: c, c-h, j, j-h, h: t, t-h, d, d-h, n: t, t-li, d, d-h, n : p, p-h, b, b-h, m:
y, r, 1, v : &, s, s, h : ; (li), • m (it.)! ‘
References are made thus :—823 (2), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
INDEX
113
Tarkasamgraha, by Annambhatta,
605.
Commentary on, by Annam¬
bhatta, 605.
Tajikasarasudhanidhi, by Nara-
yana, 784.
Tapitata, 861, 108 (where vapl 0 is a
slip of the scribe).
Tithitattva, by Raghunandana,
679-681.
Commentary on, by Kasirama,
682.
Tithidvaitaprakarana, by S'ulapani,
662.
Commentary on, by S'rinatha-
sarman, 662.
Tithinirnaya, by Anantabhatta, 845.
Tithinirnayasamgraha, by Rama-
candra, 845.
Commentary on, by Nrsimha,
845.
Titliiviveka, by S'ulapani, 679.
Tithisaranika, by DaSabala, 776.
Tirthayatratattva, by Raghunan¬
dana, 683.
Tlsata, Cikitsdkalikd, 852.
*Tegbeg Khawn, 854.
Tailinga, 474.
tTokamani (a. d. 1821), 797 .
Todaraksitipati, 271, and see Todard-
nanda.
Todala Tantra, 160.
Tripuriprakarana, by S'ankara-
carya, 549.
Trimalla, Yogatarahgini, cites Rasen-
dracintdmani, 762.
Trilocanadasa, Katantravrttipan-
jika, 377.
tTrivikramabhatta Satha (a. d. 1673),
502.
Trivikramabhatta, Damayanti-
katha, 208-210.
Dandin, Kavyadarsa, 485.
Dattakamimamaa, see Putrikarana-
mimamsa, 7i7.
Dattatreyastottara6atanamastotra,
from Brahmanda Purana, 728.
Damayantikatha, by Trivikrama¬
bhatta, 208-210.
tDayacandra Laghupandita (a.d. 1821),
son of Kj-snacandra, 789.
Darpanarayana, king, 708.
DaSabala, Tithisaranika, 776.
Dasarupaka, by Dhanamjaya, 484.
Commentary on, by Dhanika,
484.
Dadabhai, Kiranavali, 772.
Danakaumudi, by Govindananda,
643.
Damacarita, by Samaraja, 273.
Damodara, Samgitadarpana, 476-
479.
Dayatattva, by Raghunandana, 684-
686 .
Dayabhaga, by Jimutavahana, 714,
715.
Dinakara, Klieiakasiddhi, 775.
Candrarki, 775.
Divyatattva, by Raghunandana,
687.
Durgamasubodhini, by Manahka,
259.
Durgasimha, Katantravrtti, 375,
376, 826.
Durgasimha, Nanarthadhvanimafi-
jari attributed to, 445.
Durgadasa, father of +Nanugangaharu
(a. d. 1643), 583 .
Durgadasa, Subodha, 395, 396.
Durgotsavatattva, by Raghunan¬
dana, 688.
Durjanamukhacapetika, by Rama-
srama, 93.
tDurlablia, 203.
*Durlabharama, 367, probably identical
with the following.
tDurlabharama (a. d. 1780), 608.
Dutangada, by Subhata, 276-278.
tDevacandra (a. d. 1711), 752.
tDevajl (a.d. 1625), 799.
Devadatta, Dhaturatnamala, 760.
tDevanatha (a. d. 1819), 671, 677.
Devaraja, father of S'arngadhara,
755.
Devaraja II, of Yijayanagara, 476.
tDevarama (a. d. 1744), 723.
tDevasarman (a. d. 1790-1800), son of
Rama, 688.
Devikavaca, 174.
Devlbhagavata Purana, 136, cites
Nandisvara Purana, 137.
Devlmahatmya, see Candikama-
hatmya.
Devisukta, 725.
Devendra, Zavikalpalata, 498.
tDevesvara, 779.
Dya Dviveda, cites Ajnanabodhini,
548.
Dravyapadarthasamgraha, from
Prasastapadabhasya, 583.
Dravyasuddhidipika, by Purusotta-
ma, 649.
Draupadivastraharana, 211.
Dvadasamahavakyavivarana, by
Visnupuri, 557.
Dvarakamahatmya, from Skanda
Purana, 124, 815, 816.
1. DvirupakoSa, 447, 448.
2. Dvirupakosa, 449, 450.
Dvaitanirnaya, by Vacaspatimi£ra,
648.
Dvaitaparisista,byZe^avamifira,650.
Dhanamjaya , see S'rutaklrtitraividya.
Dhanamjaya, Daiarupaka, 484.
Dhanamjayavijaya, by Kancana,
279, 280.
Dhanapati (a.d. 1799), S'ankara-
caryavijayadindima, 627.
Dhanika, Dasarupakavyakhyana,
484.
Dharmakirti, cited by S'ankaracarya,
24, 4.
Dharmadasa, Vidagdhamukha-
mandana, 514-516.
Dharmitavacchedakatapratyasatti-
vicara, by Harirama, 610.
Dhatupatha Paniniya, 373.
Dhatupatha Haima, 378, 379.
Dhaturatnamala, by Devadatta, 760.
Dhanvantarlya Nighantu, 451.
Zl/iataA:a,Nagananda attributed to, 821.
tDhlresvara (a.d. 1799), 646.
Dhurtanartaka, by Samaraja, 274,
276.
Dhurtasamagama, by Jyotirisvara,
281.
Naksatrasamuccaya, by Lallavara-
hasuta, 785.
1. Nanvadatippani, 616.
2. Nanvadatippani, by Raghudeva,
617.
Nanda, Keiavavaijayantl, 717.
Putrikaranamimamsa, 717.
tNandikesvara (a.d. 1717), 96.
Nandigrama, 791.
Nandisvara Purana, 137.
IMaiasimha. patron of Vidyapati, 708.
Narasimha, Viisavadattatika, 332.
Narasimha Purana, 138, 139.
tNarahari (after a.d. 1542), 522.
Narahari, Rajanighantu, 765-767.
Nalodaya, by Ravideva (1), 219, 220.
Commentary on, by Ganesa, 219,
220 .
tNalha (a.d. 1467), 451.
Navinamatavicara, by Harirama,
611, 612.
Nagapasa, great-great-grandfather of
Narayana (a. d. 1546), 467.
Nagananda, by Harsa, 821.
Alluded to by Magha, 193.
Nagarjuna, date of (lor date of
Kaniska under whom he is said to
have flourished, cf .J.R.A.S., 1906,
p. 991; 1907, p. 171; Hoernle,
Osteology, p. 9), 374.
Yogaratnamala, 764.
Nage^a, KdvyapradlpatIka, 604.
Paribhasendusekhara, 354.
Bhasyapradipoddyota, 342-351.
Rasamafijariprakasa, 508.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
Order of alphabet a, a, i, I, u, u, r, r, 1: e, ai, o, au: k, k-h, g, g-h, h: c, c-h, j, j-h, n: t, t-h, d, d-h, n: t, t-h, d, d-h, n: p, p-li, b, b-h, m:
y, r, 1, v: £, s, s, h:(h), • in (m).
References are made thus:—823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
BODL. SANS. CATAL. APP. Q
114
Nagesa—
LaghusabdenduSekhara, 304-
366.
Laghusamkhyasutravrtti, 574.
Vaiyakaranasiddhantamafijusa,
403.
Nagojibhatta, see Nagesa.
Nanarthadhvanimafijari, 445, 446.
Nanartharatnamala, by Irugapa
Dandadhinatha, 441-^443.
Nanarthasamgraha, by Ajayapala,
427.
+Nanugangaharu (a. d. 1643 ), son
Durgadasa, 583.
Namalinganusasana, by Amara-
simha, 416-420, 829.
Commentary on, by Bhanuji-
diksita, 416.
Namasaroddhara, 422.
Nayakaratna, by Ramanuja, 527.
Narada, Urdhvamnayasamhita,
735.
1 . Naradiya Purana, 47, 7 .
2 . Naradiya Purana, 140.
Niiradiyamahasthana, 820.
Naradopapurana, 47, 7 , 140.
Narayana, father of Ravideva, 219.
Narayana, Gitagovindatika, 221,
222 .
Narayana, Tajikasarasudhanidhi,
784.
Narayana, Pra^narnava, 780.
Narayana, Bharatarthaprakasa, 14,
15.
Narayana, Bhavadyotanika attri¬
buted to, 204-207.
Narayana, Muhurtamartanda, 787.
Muhurtamartandavallabha, 787.
Narayana, Vrttaratnakaravivrti,
467.
Narayana, Hitopadesa, 338.
Narayanagita, by Nilakantha, 736.
Narayanatirtha,Samkhyacandrika,
569.
Narayanadeva, Samgitanai ayana,
480.
Narayanavarma, from Bhagavata
Purana, 89.
Narayana Svamin, 736.
Narayanairama, Bhedadhikkara-
satkriya, 556.
Narlpattana, 779.
Nibandhasamgraha, by Dallana,
740.
Nirupama, see Irugapa.
*Nilakantha, 622.
Nilakantha, Kasikatilaka, 229.
Nilakantha, Narayanagita, 736.
Nilakantha, Bharatabhavadipa,
16-18."
Mantrarahasyaprakasika, 734.
INDEX
Nilakantha, Vyavaharamayukha,
655. 656.
S'raddhamayukha, 057.
Nilamata, 818.
Nrsimha, of Kasmir, 705.
Nrsimha, see Chalari Nrsimha.
Nrsimha, Tithmirnayasamgraha-
vrtti, 845.
Nrsimha&rama , Bhedadliikkara, date of,
656.
Naisadhiyacarita, by Harsa. 200-
203.
Commentary on, by Narayana,
204, 205, 207.
Commentary on, by S'esarama-
candra, 204-206.
Nyayamalavistara, by Madhava,
528-532.
Nyayaratnamala, by Parthasarathi-
misra, 527.
Commentary on, by Ramanuja,
527.
Nyayavagisa, Kavyacandrika, 499.
Nyayasiddhantamanjari, by Jana-
kinatha Bhattacaryacudamani,
581.
Nyayasiddhantamala, by Jayarama,
582.
Nyayasiddhantamuktavali, by Vis-
vanatha, 579.
Commentary on, by Mahadeva,
580.
Nyayasudha, by Some^vara, 522.
Nyayasutra, by Gautama, 670.
Commentary on, by Visvanatha,
570.
Nyayasutra , by Jaimini, 520-532,
830, 837.
Nydsa, see Jinendrabuddhi.
Pancakrosamahatmya, from Kasi-
mahatmya of Brahmavaivarta
Purana, 71.
Pancatantra, by Visnusarman, 335-
337.
Pahcadasi, by Bharatitirtha and
Vidyaranya, 540.
Commentary on, by Ramakrsna,
541, 542.
Fancadasisamasa, 543.
Paficadravaladesa, 474.
Pancapadikavivarana, by Praka4at-
man, 538.
Pancupadl, by Padmapada, 538, 68 .
Pancikaranavarttika, by Suresvara,
554.
Pandyapurusottama, father of +Kr?na-
deva (a. d. 1780 ), 280.
Patafijali (for date, cf. J.R.A.S., 1908 ,
p. 175 , n. 2 ), Mahabhasya, 342-351.
Patafijali, Yogasutra, 561.
Padavakyaratnakara, by Gokula-
natha, 019.
Padarthadipika, by Kesavarka, 820.
Padmanabhadatta, Bhuriprayoga,
435, 430.
Siddhasarasvatadipika, 173.
Supadma, 401.
Padmapada, pupil of S'ahkaracarya,
538, 68 .
Padma Purana, 50-65.
Karttikamahatmya, 59.
Kriyayogasara, 56.
Jalandharopakhyana, 807.
Prayagamahatmya, 60.
Maghamahatmya, 57, 68 .
S'ivagita, 61.
Param5ra, descendents of, 317.
1 . Paramarthasara, 838.
2 . Paramarthasara, by Abhinava-
gupta, 675.
Commentary on, by Yogaraja,
675.
tParasurama (a. d. 1800 ), son of Utta-
rarfuno, 790.
tParasulala (a. d. 1821 ), 93, 94, 304,
340.
Paraiarabhatta, Gunaratnakosasto-
tra, 235.
Paraiarasmrtivyakhya Madhaviya,
636-639.
Paribhasendusekhara, by Nagoji¬
bhatta, 354.
Pavanavijaya, 107.
Pdnini, date of, 342-351, 45 .
P&tcdavijaya, authorship of, 342-351,
45-
Partha Itihasasamuccaya, 38.
P arthas ar athimi sra—
Nyayaratnamala, 627.
S'astradipika, 620.
Piiigdlapradlpa, by Laksmhidtha (a. d.
i 601 ), 468.
tPltambara (a. d. 1640 ), son of S'iva-
dasa, 793.
tPitambarasarman (a. d. 1813 , 1814 ),
154, 100, 21 , 480, 488, 648, 650,
070, 692.
Punyasundara, Haima Dhatupatha,
379.
Putrakramadipika, by Ramabha-
dra, 716.
Putrikaranamimamsa, by Nanda,
717.
Puranas, date of (cf. Ind. Ant., XXVI,
323 - 328 ), 50-55, 75, 98, 103, 105,
120 - 122 , 120 .
Puranasarvasva, by Halayudha,143,
144".
Purusottama, 048.
Purusottama, Avataravadavali, 94.
Dravyafiuddhidipika, 049.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
Order of alphabeta, a, i, I, u, u, r, r,}: e, ai, 0 , au: k, k-h, g, g-h, n: c, c-h, j, j-h, 3: t, t-h, d, d-h, n: t, t-h, d, d-h, n: p, p-h, b, b-h, m :
y, r, 1 , v: s, s, s. h : : (h), • in (m).
References are made thus823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
Purusottamatirthaprayogatattva,
by Raghunandana, 689.
Purusottamadeva, Ekaksarakosa,
431, 432.
Jnapakasamuccaya, 353.
Dvirupakosa, 449, 460.
S'abdabhedaprakasa, 429, 430.
Puskaraksetra, 541.
Puspadanta, Mahimnahstava, 237.
*Pusavarama, 384.
tPuranda (a. d. 1704 ), 110 .
Purnabhadra , recension of Pancatan-
tra, 335.
Prthvidhara, Bhuvanesvaristotra,
173.
*Pope (A.), 854.
Portraits of Indian kings, 854.
Prakasatman, Paneapadikaviva-
rana, 538.
Prukriyakaumudl , by fiamacandra, 355 ;
824, 825.
Commentary on,by Vitthala,355.
Pracandapandava, by Rajaiekhara,
282,* 283.
Pratapa, accession to throne (a. d. 1295 ),
180, 181.
Prataparudriya, commentary on, by
Kumdrasvamin , 180, 181.
Pratyaktattvadipikd, by Citsukha, 615.
Commentary on, by Pratyaksa-
rupa, 615.
Pratyaksarupa, Pratyaktattvadi-
pika, 615.
Pradyumnavijaya, by S'ankara, 285.
Prabodhacandrika, by Vaijala, 370.
Prabodhacandrodaya, by Zrsna-
misra, 286-288, 822.
Commentary on, by GaneSa, 286.
Commentary on, by Ramadasa,
286.
Commentary on, by Rudradeva,
288.
Prabhasaksetratirthayatranukra-
ma, from Skanda Purana, 817.
tPrabhuji (a. d. 1741 ), 463.
Pramitaksara, by Rama, 788.
Prayagamahatmya, from Padma
Purana, 60.
Prayagamahatmya, from Matsya
Purana, 96.
Prayogamrta, by Vaidyacintamani,
751.
Prasastapadabhasya,Dravyapadar-
thasamgraha from, 583.
Prasnarnava, by Narayana, 786.
Prasannaraghava, by Jayadeva,289.
Prajyabhatta, Rajavalipataka, 314.
Pramanyavadarahasya, by Bhava-
nanda, 597.
Prayascittatattva, by Raghunan¬
dana, 690-692.
Thick type = Sanskrit authors, or works,
Order of alphabet:—a, a, i, I, u, 0, r, r, ]: e
y, r, 1, v: 6, s, s, h: ; (h), • m (hi).
References are made thus823 ( 2 ), 104 =
INDEX
Prayascittapaddhati.by Zamadeva,
709.
Praya^cittaviveka, by S'ulapani,
660.
Commentary on, by Govinda-
nanda, 661.
Pretakalya, 46.
Praudhamanorama, by Bhattoji-
diksita, 356-359.
Glosses on, 356.
Phetkarini Tantra, 151.
Ballala, Bhojaprabandha, 320.
Bana, Zadambarl, 334.
Nagananda attributed to, 821.
Ratnavali attributed to, 303.
Badarayana, Badarayanasutra, 633.
Badarayanasutra, by Badarayana,
533, 537.
Commentary on, 537, 639 (frag.).
Commentary on, by Sankaracarya,
534, 535.
Super-commentary on, by Govin-
dananda, 534, 535.
Commentary on, by Ramanuja,
536.
1 . Balabharata, by Amaracandra, 37.
2 . Balabharata, by RajaSekhara,
282, 283.
Birudavall, by Raghudeva, 244.
Bilvamahgala, Krsnakarnamrta,
230.
Bilhana, Caurapancafiika, or Bilha-
nakavya, 245.
Bilhana, name of Dallana, 740.
Buba, lather of "^itthaladiksita, 798.
Brhajjataka, by Varahamihira, 779,
*780.
Commentary on, by Bhattotpala,
780.
Brhatsamhitd, by Varahamihira, 777,
778.
Commentary on, by Bhattotpala,
777, 778.
Brhadabhidhanacintamani, by Ha-
layudha, 426.
Brhadbrahmottarakhanda, from
Skanda Purana, 126.
Brhannaradiya Purana, 47-49.
Bauddhadhikkaradidhiti, by Ra-
ghunatha, 602.
tBrahmadeva (Abhira, A. d. 1709 ), 173.
Brahmapura, 367.
Brahma Purana, 62-64.
Brahmayamala Tantra,
Ramakavaca, 153.
Ramasahasranamastotra, 152.
Brahmavaivarta Purana, 65-68.
Zasimahatmya, 70.
Pancakrosamahatmya, 71.
115
Brahmavaivarta Purana—
Prakrtikhanda, 69.
Svapnadhyaya, 808.
Brahmanda Purana, Adhyatma-
ramayana, 72-74, 731.
Dattdtreydstoltarasatandmastotra,
728.
Bhaktiratnavall, by Visnupuri, 90.
Commentary on, by Visnupuri,
91.
Bhagavadgita, 22 , 23, 801—803.
Commentary on, by S'ankara-
carya, 24.
Commentary on, by S'ridhara-
svamin, 25.
tBhatalllara (a. d. 1670 ), 747.
Bhattanarayana, Venisamhara,
306-309.
Bhattikavya, wrongly attributed to
Bhartrhari, 246.
Bhattibhaia, son of Bappa, 246.
Bhattojidiksita, date of, 367.
Praudhamanorama, 366-359.
S'abdakaustubha, 352.
Siddhantakaumudi, 356.
Bhattotpala, Commentaries on
Brhajjataka, 780.
Brhatsamhita, 777, 778.
Bhadrapura, 1-13, 2 .
Bharatakadvatrimsika, 329.
Bharata, father of Dallana, 740.
Bharatasena, Commentaries on
Meghaduta, 218.
S'isupalavadha, 198, 199.
Bhartrhari, S'atani, 246, 247.
Bhavabhuti, Uttararamacarita,261,
262.
Mahaviracarita, 260.
Malatimadhava, 259.
*Bhavani, 463.
Bhavananda, Pramanyavadaraha¬
sya, 597-
Bhavisya Purana, 75, 77.
Ganesastavaraja, 78.
Cited in Varaha Purana, 105.
Bhavisyat Purana, see Bhavisya
Purana.
Bhavisyottara Purana, 76.
Bhavesvara, king of Mithila, 708.
*BhaTjTvana, 463.
Bhagavaita Pur ana, 79-87, 809-812.
Date of, 126. ’
Used in Varaha Purana, 105.
Before Devibhagavata Purana,
136.
Narayanavarman, 89.
Commentary on, by S'ridhara-
svamin, 79 - 86 , 811, 812.
Bhattadipika, by Zhanda, 836, 837.
Bhanujidiksita,Vyakhyasudha,416.
in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
, ai, o,au: k, k-h,g, g-h, n: c, c-h, j, j-h, n: t,t-h,d, d-h, n: t, t-h,d,d-h,n: p, p-h,b, b-h, m:
MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
Q 2
116
Bhanudatta, Rasatarangini, 500.
Rasamanjari, 507, 508.
tBhamnajl (a. d. 1750 ), son of Vidya-
dliarn, 757, 95 -
Bhaminivilasa, by Jagannatha, 230.
Commentary on, by Manirama,
238.
Bharatabhavadipa, by Nilakantha,
16-18.
Bharatarthadipika,l>yArjunamisra,
14,15.
Bharatarthaprakasa, by Narayana,
14, 15.
Bhfuatltlrtha, abbot of SVngeri, 528,
629.
Pancadasi, 540-542.
Bhdravi, Kirdtdrjuniya, 192.
Bhargavajnatlya, 851, 108 .
Bhavadyotanika, by Narayana,
204-207.
Bhavaprakasa, by Misra, 743, 744.
1 . Bhavarthadipika, by Janardana,
405.
2 . Bhavarthadipika, by S'ridhara-
svamin, 79-87, 811, 812.
Bhasapariccheda, by Visvanatha,
577, 578.
Commentary on, by Visvanatha,
679.
Super-commentary on, by Maha-
deva, 580.
Bhasamanjari, 827.
Bhasyapradipoddyota, by Nagoji-
bhatta, 342-351.
Bhasyaratnaprabha, by Govinda-
nanda, 534, 535.
Bhasa, Mrcchakali/ca attributed to, 250.
Bhaskara, see Irugapa.
Bhaskara, Karanakutuhala, 774.
Bhaskara, Kamasutravyakhya,517.
Bhdskarardya, Bhdttacandrikd, date of,
836, 837.
Bhaskarasarman, Vrttaratnakara-
setu, 466.
Bhillama, Yadava of Devagiri, 471.
fBhisarldasa (a. D. 1736 ), 1-13, 2 .
Blnthi, 646.
Bhlnrvala (1), 815.
Blninapala, king of Budaun, 768.
Bhismastavaraja, 26, 27.
Bhuvanesvarlstotra, by Prthvi-
dhara, 173.
Commentary on, by Padmana-
bhadatta, 173.
tBhuvanhama, 528, 529.
Bhudarnji, 245, 32 .
tBhudeva (a. d. 1774 ), son of Vyasatu-
lasi, 38, 57, 59, 98, 113, 169, 22 ,
186, 211, 232, 237, 31 , 240, 278,
379, 382, 386, 420, 605, 641, 649.
Bhudeva, Kasikatilakatika, 229.
INDEX
Bhudhara, Suryasiddhantaviva-
rana, 773.
Bhuriprayoga, by Padmanatha-
datta, 435, 436.
Bhusanabhatta, Kadambari, 334.
Bhedadhikkarasatkriya, by Nara-
yanasrama, 556.
Bkairava, or Haiinai-ayana, Maithila
prince, 267, cf. 648.
Bhairava Tantra, Anandakanda
from, 759.
Bhairavasimha, see Harinarayana.
Bhairavastotra, from Rudrayamala,
729.
Bhoja, date of, 776.
Cited by Jimutavahana, 714.
Yuktikalpataru, 800.
Rajamartanda (cf. J.li.A.S. , 1908 ,
p. 526 ), 561.
Sarasvatlkanthabharana, 489,
490.
Bhojadeva, father of Jayadeva, 221 .
Bhojaprabandha, by Ballala, 320 .
Mankhuka, Alamkarasarvasva at¬
tributed to, 495.
Manjubhasini, i>y Krsnacarya, 170.
Manjusakuncika, by Krsnamitra,
404.'
Manirama, Bhaminivilasatlka, 236.
*Matirfima (after a. d. 1801 ), 73, xo.
Matsya Purana, 95, 813, 814.
Cites Narasimha Purana, 138.
Dates before a. d. 1000, 75 .
Mathura, 474.
Mathuranatha, Anumanatippanl,
590-592.
Mathuramahatmya, from Varaha
Purana, 107, 108.
Mathuresa, S'abdaratnavali, 43&,
440.
Madana, Kalyanarajaprasasti, 228.
Madanaparijata,by Visvesvara, 651,
652.
Madanapala (a. d. 1360 ), prince of
Kastha, 651, 652, 653.
Cited in Bhavaprakasa, 743, 93 .
tMadanamohanadevasarman (a.d. 1813),
706.
Madhuraniruddha, by Candrase-
khara, 290.
Madhusudana, recension of Maha-
nataka, 295.
Madhusudana Sarasvati—
Advaitaratnaraksana, 555.
Atmabodhavrtti, 546, 547.
Madhusudanananda, teacher of tHari-
liar&nanda (A. D. 1749), 61 .
Madhyasiddhantakaumudi, by Va-
radaraja, 367-369.
Madhva, date of, 669.
Manoharasarman, Subodhini, 835.
Mantrabhagavatavyakhya, by Nila-
kantha, 734.
Mantramahodadhi, by Mahidhara,
154.
Commentary on, by Mahidhara,
155.
Mantrarahasyaprakasika, by Nila¬
kantha, 734.
Mammata, Kavyaprakasa,500-504.
Mayura, Mayurasataka, 819.
*Marsh (Archbp. N.), owner of MSS.
Marsh.
Malamasatattva, by Raghunan-
dana, 693.
Malimlucatattva, see Malamasa¬
tattva.
Malladeva, Kalajnana, 749.
Mallinatha, Commentaries on—
Kiratarjuniya, 192.
Zumarasambhava, 184.
Meghaduta, 218.
Raghuvamsa, 180-183.
S'isupalavadha, 196, 197.
Mallumpakbyagaccha, 802, 101 .
*Mahadeva (after a.d. 1801 ), 73, 10 .
Mahadeva, king of Devagiri, patron of
Yopadeva, 92.
Mahadeva—
Atmavajativicara, 608.
Sad.rsyavada, 609.
Mahadeva, Nyayasiddhantamuk-
tavalidipika, 580.
Mahadeva, Muhurtadipaka, 790.
Mahanataka,by Damodara,291-295.
Commentaryon,by Mohanadasa,
291-293.
Mahabharata, 1-18.
Commentary on, by Arjuna-
mi 6 ra, 14, 15.
Commentary on, by Narayana,
14, 15.
Commentary on, by Nilakantha,
16-18.
Used in Devibhagavata Purana,
1.36.
See also Harivamsa.
Mahabhasya, by Patanjali, 342-351.
Commentary on, by Kaiyata,
342-351.
Commentary on, by Bhattoji-
diksita, 352.
Super-commentary on, by Na-
gojibhatta, 342-351.
Maharnavanibandha , 653.
Mahaviracarita,byBhavabhuti,260.
Alahimuda (= Mahmud Shah), 817.
Mahimnahstava, by Puspadanta,
237, known to Nandisvara Purana,
137.
Commentary on, by Ahobala, 237.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabet:—a, a, i, I, u, u, r, f, 1: e, ai, 0 , au: k, k-h, g, g-h, n: c, c-h, j, j-h, h: t, t-h, <J, d-h, n: t, t-h, d, d-h, n: p, p-h, b, b-h, m:
y, r, 1 , v : £, s, s, h : : (hj, • m (lii).
References are made thus823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
Mahltata, 851, 108 .
* Mahidhara (a. d. 1529 ), son of Laliiia
(also written Lauha, Lagliu), 848,
861, 852.
Mahidhara, Mantramahodadhi,
154.
Mantramahodadhinauka, 155.
Yogavasisthasara vivarana, 663,
564.
Ramagitavyakhyana (frag.), 731.
Mahlpa, Anekarthatilaka, 833.
S'abdaratnakara, 832.
Mahlpala (a. d. 917 ), of Kanauj, 284.
Mahendrapala (a. d. 903 ), of Kanauj,
284.
Mahesa, father of Ksemakarna (a. d.
1570 ), 481.
Mahesvara, Vamanavrttitika, 488.
Mahesvara, Visvaprakasa, 428.
Magha, S'isupalavadha, 193-199.
Imitated by Ralnakara, 193.
Date of, 332.
Maghamahatmya, from Padma Pu-
rana, 57, 58.
Madavivimdara, 25.
Mddhava , author of commentary on
Rgveda, 372.
Madhava, brother of Sayana, 372, see
also Vidyaranya.
Kalanirnaya, 642.
Jaiminiyanyayamalavistara,
528-532.
Pancadasi, 540-543.
Parasarasmrtivyakhya, 636-
639.
Samksepa 6 ankaraj ay a,626-628.
SarvadarSanasamgraha, 622,
623.
Madhava, RugviniScaya, 745-747,
851.
fMadhavajl (a. d. 1669 ), 709.
fMadhavarama (a. d. 1833 ), 464, 584.
Madhavanalakhyana, 339, 340.
fMadhorama (a. d. 1821 ), 489, 61 , per¬
haps identical with the following.
fMadhorama (a. d. 1835 ), 41, 6 .
Manadeva, of Nepal, 259.
Manava Dharma 6 astra, 841.
Mananka, Malatimadhavatika, 259.
Mayana, father of Sayana, 372.
Markandeya Purana, 97.
Candikamahatmya from,98-100.
Commentary on,by S'antanu, 98.
Devimahatmya, see Candika¬
mahatmya.
Malajnatlya, 816.
Malatimadhava, by Bhavabhuti,
259.
Commentary on, by Jagaddhara,
259.
Commentary on,by Mananka,259.
INDEX
Malavikagnimitra, by Kalidasa,
256, 257.
Mitaksara, by Vijfianesvara, 631,
842-844.
Commentary on, by Laksmidevi,
632.
Commentary on, by VisveSvara,
633, 634.
Compendium of, by Radhamo-
hanasarman, 635.
MitramiSra, Mitrodaya, 713i
Mitrodaya, by Mitramisra, 713.
Mirza Golam Mahomet, 854.
*Mill (dr. W. H.), former owner of
MSS. Mill.
Misra, Bhavaprakasa, 743, 744.
Misarumisra, Vivadacandra, 718.
Minarajajataka, by Yavanesvara,
781.
Mimamsanyayaprakaia, by Apa-
deva, 524.
Mimamsabhasyavivarana, by Ku-
marilasvamin, 525.
Muktaplda (a. d. 726 ), of Kasinlr, 840,
cf. 335.
Muktivadavicara, 603.
Mufija, of Dhar, cited by Kaviraja (?),
212 .
Mudraraksasa, by Visakhadatta,
296-299’.
Commentary on, by VateSvara,
300.
Murari, Anargharaghava, 263-268.
Muhurtacintamani, by Rama, 788,
789.
Commentary on, by Rama, 788.
Muhurtadxpaka, by Mahadeva,790.
Muhurtamartanda, by Narayana,
787.
Muhurtamartandavallabha, by Na-
rayana, 787.
Mrcchakatika, 250.
Commentary on,by Lalladiksita,
250.
Meghaduta, by Kalidasa, 218.
Commentaries on, by Bharata-
sena, Ramanatha, Kalyana-
malla, Mallinatha, Vacaspati-
govinda, Sanatanasarman, 218.
Meda, pathaka, 661, 652, 82 .
Modhajnatiya (cf. Knauer, Manava
Grhya Sutra , p. xxxiii), 426.
*Morarajl, 463.
Mohanadasa, Mahanatakavrtti,
291-293.
tMohanarSma (a. d. 1820 ), 452, 57 .
Yajurvedivrsotsargatattva, by Ra-
ghunandana, 697.
YajurvediSraddhatattva, by Raghu-
nandana, 706.
117
Yajnatman, father of Parthasarathi-
misra, 526.
Yayaticarita, by Rudradeva, 301,
302.
Yavanesvara, Minarajajataka, 781.
Yasovarman, of Kanauj, 259.
Yajnavalkya Dharmasastra, 630.
Commentary on, by Vijnane-
svara, 631.
Super-commentary on, by La-
ksmideva Payagunde, 632.
Super-commentary on, by Visve-
6 vara, 633, 634.
tYadavendra (a. d. 1665 ), 701.
Yamunacarya, Alamandarastotra,
227.
Yuktikalpataru, attributed to Bhoja,
800.
Yogatarahgini, by Trimalla , cites Ra-
sendracintamani. 762.
Yogaratnamala, by Nagarjuna, 764.
Commentary on, by Gunakara,
764.
Yogaraja, Paramarthasaravivrti,
575.
1 . Yogavasisthasara, by Abhinanda,
840.
2 . Yogavasisthasara, 563, 564.
Commentary on, by Mahidhara,
563, 564.
Yogasata, 752.
Yogasastra, Videhamuktyadika-
thana from, 668 .
Yogasarasamgraha, by Vijnana-
bhiksu, 562.
Yogasutra, by Patanjali, 561.
Commentary on, by Bhoja, 561.
Yogini Tantra, 156.
tRaghu (1), 579, 73 .
Raghudeva, Nanvadatippani, 617.
Raghudeva, Birudavaii, 244.
Raghunandana—
Ahnikatattva, 671, 672.
Ekadasitattva, 673.
Krtyatattva, 674.
Grahayajnatattva, 675.
Chandogasraddhatattvaprama-
na, 703, 704.
Jalasayotsargatattva, 676.
Jyotistattva, 677, 678.
Tithitattva, 679-682.
Tirthayatratattva, 683.
Dayatattva, 684-686.
Divyatattva, 687.
Durgotsavatattva, 688 .
Purusottamatirthaprayogatat-
tva, 689.
Prayaficittatattva, 690-692.
Malamasatattva, 693.
Yajurvedivrsotsargatattva, 697.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabeta, a, i,I, u, u, r, r,J: e,ai, o,au: k, k-h, g, g-h, h: c, c-h,j, j-h, n: t, t-h, d, cl-h, n: t, t-h, d, d-h, n: p,p-h, b,b-h, m:
y, r, 1 , v: 3, s, s, h : 5 (h), • m (m).
References are made thus:-823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
118
INDEX
Raghunandana—
Yajurvedisraddhatattva, 788.
Vastuyagatattva, 695.
Vivahatattva, 690.
Vyavaharatattva, 099.
Vratatattva, 700.
S'uddhitattva, 701.
S'udrakrtyavicaratattva, 702.
Samskaratattva, 707.
Samagavrsotsargatattva, 698.
*Raghun<itha, 774.
Raghunatha, Anumanadidhiti,
587-589.
Atmatattvavivekavrtti, 002 .
Raghunatha, Rasikaramana, 318.
Raghuvamsa, by Kalidasa, 170-179.
Commentary on, by Mallinatha,
181-183.
Ranganatha, Vikramorvasitika,
255.
llanyandtha (a. n. 1603 ), Siiryasid-
ilhantayudharthaprakaSaka, 320.
llanavlra, of Kasmlr, 743, 93 .
Ratnakantha, 314.
Ratnakosa, 834.
Ratnakosakarikavicara, 813.
Ratnagarbha, Vaisnavakutacan-
drika, 111 .
Ratnadarpana, by Ratnesvara, 490.
Ratnakara, imitates Magha, 193.
Ratnakara (a. d. i 7 i 4 ), Vratakalpa-
druma, 865-087.
Ratnavali, 303, 304.
Ratnesvara, Ratnadarpana, 490.
Haviklrti , cites liharavi, 192.
Ravideva, Nalodaya, 219, 220 .
Rasacandrika, by S'tmkara, 254.
RasataranginT, by Bhanudatta, 506.
Rasamanjari, by Bhanudatta, 507.
Commentary on, by Nagesa, 508.
Ilasaratnapradtya , cited by Todara-
nanda. 782.
Rasarajalaksmi, by Ramesvara, 701.
Rasavati, by Jumaranandin, 393.
Rasikaramana, by Raghunatha, 318.
Rasendrakalpadruma, by Rama¬
krsna, 703.
Rasendracintamani, by Ramacan¬
dra, 762.
Ragamala, by Ksemakarna, 481,
482.
Ragavibodha, by Soma, 475.
Raghava, Ganesastuti, 853.
Raghava, Hastaratnavali, 483.
Raghavapandaviya, by Kaviraja,
212 .
lldghavapdndaviya , by S'rutakirtitrai-
vulya, 2 i 2 .
Rajatarangini, by Kalhana, 314,
318.
Rajatarangini, by Jonaraja, 315.
tRajadharajl (a. n. 1739 ), 802, 101 ,
808, 828, 847.
Rajadharmakaustubha, see Vyava-
haradidhiti.
Rajanighantu, bv Narahari, 705.
Index to,' 700, 787.
Rajanitisastra, by Canakya, 238.
Rajamartanda, by Bhoja, 501.
Rajasekhara—
Balabharata, 282, 283.
Viddhasalabhanjika, 284.
Rajanaka Yogaraja, see Yogaraja.
llfijanakarucaka (= Ruyyaka), 495.
Rajavalipataka, by Prajyabhatta,
315, 310.
tRajyadurama, 105.
Ratiiapura, 43.
Ranapura, 815.
Riltula, name of S arhgadhara, 755.
Ratrisvkta, 725.
tKadbakrsna, 135.
Radbanatbasarinan (a.D. 1807 ), 143,
144.
Radhamohanasarman, Mitaksara-
yah Siddhantasamgraha, 635.
Radharasasudhanidhi, by Harivam-
6 a, 239.
tRfuna, 100.
tRama, 683.
*Rama, 381.
* llama (a. d. 1817 ), 22, 184.
Rflma, father of tDevasarmnn (a. i).
1790 - 1800 ) and tYidyavagisa (a. d.
1821 ), 088, 689.
Rama, Adhanapaddhati, from Kar-
madipika, 853.
Kundakrti, 853.
Rama, Gitagirisa, 234.
Rama, Pramitakaara, 788.
Muhurtacintamani, 788, 789.
Ramakavaca, from Brahmayamala
Tantra, 153.
Ramakrsna, Pancadasidipika, 541,
542. *
Ramakrsna, Rasendrakalpadruma,
783.
Ramakrsnakavya, by Surya, 240.
Rama Krsna Bhatta, Durjanamu-
khacapetika attributed to, 93.
Ramaglta, from Adhyatmaramaya-
na, 731.
Commentary on, by Mahidhara,
731.
Ramaghata, 125.
Rainacandra (a. d. 1744 ), 723.
tRamacandra (a. d. 1821 ), of Kasmlr,
311, 588.
tRamacandra (a. n. 1733), Ayacita, son
of Raghunatha, 838, 837, 106 .
Ramacandra, Tithinirnayasam-
I graha, 845.
Ramacandra—
Prakriy akaumudi, 355,824,825.
Ramacandra, Rasendracintamani,
702.
Ramacandracaritrasara, by Agni-
vesa, 213.
Ramacandrastavaraja, 161.
Ramacandra S'esa, Bhavadyota-
nika, 204-207.
Ramacandra 6 rama, Siddhantacan-
drika, 388, 387.
Ramacarana, Sahityadarpanatika,
611-513.
tRamatanu (a. d. 1734 ), 096.
tRamatanudevasnrman (a. d. 1780 -
1800 ), 888 , 898, 707.
Ramatarkavagisa, Unadiko 6 avrtti,
399.
*Rauiadayala, 100.
Ramadasa, Prabodhacandrodaya-
tika, 286.
Ramadeva, Vidvanmodatarangini,
829.
Ramanatha, Meghadutatika, 218.
lUunandtha VidyCivacasputi, Abhijndn i-
iakuntalatlkd, 218.
tRiimanarsiyana (a. d. 1821 ), 517.
Ramaprasada, pupil of Ramai.anda,
730.
Ramabhadra, Putrakramadipika,
710.
Ramabhadra Rupanarayana (a. d. 1520 ),
king, 048.
Ramabhadra Sarvabhauma, Ku-
sumafijalivyakhya, 801.
Ramamantrapatala, 732.
ltamavarinau, father of Ramavarman,
73, 10 .
Ramavarman Yuvaraja, son of king
Ramavarman, 73, 10 .
Ramavilasakavya, by Harinatha,
241.
tRamasarman (a.d. 1822 ), 710.
Ramavarman, Unadikosa, 399,400.
Ramasahasranamastotra,tiom Brah¬
mayamala Tantra, 152.
Ramasimhadeva, Ratnadarpana, writ¬
ten for, 490.
Raiminanda, pontifex, 738.
Ramananda, Kaiikhandavrtti, 120-
122 .
Ramanuja, Nayakaratna, 527.
Ramagitastotra, 733.
Vedantapradipa or S'ribhasya,
633, 530.
S'riramapaddhati, 733.
Ramayana, byValmiki, 39-41,804-
806.
RamaVrama, Durjanamukhacape-
tika, 93.
Ramesvara, Rasarajalaksmi, 761.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabet:—a, a, i, I, u, u, r, r, J: e, ai, 0 , au: k, k-h, g, g-h, h: c, c-h, j, j-h, n: t, t-h, d, d-h, n: t, t-h, d, d-h, n: p, p-h, b, b-h, m :
y, r, 1, v : 4, s, s, h: ; (h), • m (iii).
References are made thus: —823 ( 2 ). 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
INDEX
*Ramesvarabhatta, 520, 623.
Rame£vara£arman, S'abdamala,
437, 438.
Rugviniscaya, by Madhava, 745-'
747, 851.
Commentary on, by Vacaspati,
740.
Rucipati, Anargharaghavatika,287.
Rudra, Karakavada, 018.
Rudrajapa, 723.
Rudrajapya, from Vajasaneyi Sam-
hita, 724.
Commentary on, by Uvata, 724.
Rudrata, Kdvyalamkdra, 491.
Rudradeva, Prabodhacandrodaya-
tlka, 288.
Rudradeva, Yayaticarita, 301, 302.
Rudrabhatta, S'rngaratilaka, 491,
date of, 335.
Rudrayamala Tantra, 145.
Bhairavastotra from, 729.
Rudrasamhitd, 113.
Ruyyaka, Alamkarasarvasva, 495,
490.
Rupa, Vidagdhamadhava, 306.
Rupanarayana, 401.
Rupapura, 799.
tRupavardhana (a. d. 1762 ), 763.
Rekhaganita, by Jagannatha, 797.
Revamahatmya, from Vayu Pur ana,
114-110.
Romaka Siddhanta, 790.
*Laksmana (A. d. 1833 ), 509.
Laksmanakavaca, 105.
Laksmana Desikendra, S'aradati-
laka, 100 .
Laksmanasena, era of, 221 , 29 , 000 .
Laksmidevi Payagunde 1 Mitaksa-
ravyakhyana, 032.
Lakamidevi, see also Lakhima.
tLaksmln&tha, 474.
Laksmlnatha (a. d. 1601 ), Pihgalapra-
dipa, quotes Chandomafijarl, 408.
Laksmisukta, 725.
Lakamiatotra, 242.
Lakhima (LaksmI) Devi, wife of Candra-
simha, 708.
Patroness of Miaarumiira, 718.
tLaghu, see fLaulia.
Laghuiabdaratna, by Haridiksita,
350.
Laghu£abdendu£ekhara, by Nage£a,
304-300.
Commentary on, by Vaidyana-
tha Payagunde, 300.
LaghuSiva Purana, from Skanda
Purana, 127, 128.
Laghusamkhyasutravrtti, by Na-
geSa, 574.
Lalitaditya, of Ka^mTr, 259.
Lallavarahasuta, Naksatrasamuc-
caya, 785.
tLalladiksita (a. D. 1821 ), 200.
Lalladiksita,Mrcchakatikasetu,250.
tLallesvara (a. d. 1824 ), 257.
Lalhakatara, 43.
tLahiia, see tLauha.
Ladajnatlya, 820.
Lasena, 281.
Linga Purana, 101.
Lingavi 6 esavidhi, by Vararuci, 371.
Lekhakamuktamani, by Haridasa,
799*
*Lewin (S. H.), 533.
Lokanatha Cakravartin, Alamkara-
kaustubbatika, 492-494.
Lolambaraja, Vaidyajivana, 754.
Laukikavisayavicara, 614.
Lauha, father (?) of scribe (a. d. 1529 ),
848, 851, 852.
Vakratundastaka, 243.
Vate 6 vara, Mudraraksasatlka, 300.
Vatsabhatti, 240.
Van&rasa, 005-067.
Varadaraja, Madhyasiddhantakau-
mudi, 367-369.
Laghukaumudl, 367.
Vararuci, Lingavisesavidhi, 371.
Varaha Purana, 105, 106.
Mathuramahatmya from, 107,
108.
Varahamihira,Brhaj j ataka,779,7 80.
Brhatsambita, 777, 778.
Vallabha, father of Krsnacarya, 170.
Vallabha, teacher of Purusottama, 94.
Vallabhanandana, 94.
Vasisthasamhita, 565.
Vagbhata, father of Devendra, 498.
Vagi'hata , medical writer, the elder,
741, 742.
Vagbhata, Astangahrdayasamhita,
741, 742, 848.
Vagbhata, Vagbhatalamkara, 609.
Vagbhatalamkara, by Vagbhata,
509.
Vacaspati , 538, 68 .
Vacaspati (for date, cf. Hoernle, Osteo¬
logy, p. 17 ), Atankadarpana, 740.
Vacaspatigovinda, Meghadutatika,
218.
VacaspatimiSra, jurist, date of, 048.
Guru of Kesavamisra, 650.
Dvaitanirnaya, 648.
Vivadacintamani, 647, 648.
S'uddhinirnaya, 048.
Vacaspatimi^ra (cf. J.R.A.S., 1908 ,
pp. 522 - 526 ), Samkhyatattvakau-
mudi, 670-574.'
Vajasaneyi Samhita, Rudrajapya
from, 724.
119
+Vanlvanda (a. d. 1816), 79-81, 11 , 480 .
Vdtsydyana, Kamasutra, 517.
VadyajI, pupil of fRajadharajl (a. d.
*739)1802,101.
Vamana, Kavyalamkaravrtti, 487,
488.
Cites Magha, 193.
Vamana, Kasikavrtti, 823.
Vamana Purana, io2.
Vamanavrttitika, by Mahesvara,
488.
Vamuka, father of Rudrata, 491.
Vayadugaccha, 37.
Vayu Purana, 103, 104.
Gayamahatmya from, 117, 118.
Revamahatmya from, 114-116.
Varanasi, 355, 46 .
Varaha Purana, see Varaha Purana.
Varendra, clan, 160.
Valmiki, Ramayana, 39-41, 804-
800.
Vasavadatta, by Subandhu, 332.
Commentary on, by Jagaddhara,
333.
Commentary on, by Narasimha,
332.
Vasisthalainga Purana, 141.
Vasudeva, 815.
Vastuyagatattva, by Raghunan-
dana, 695.
Vikramasila, father of Haravarsa, 840.
Vikramaditya VI (a. d. 1076 - 1127 ),
842-844.
Vikramorvaii, by Kalidasa, 255.
Commentary on, by Ranganatha,
255.
Vijayacarya, grandfather of Laksmana,
160.
Vijnanabhiksu,Yogasarasamgraha,
562.
Vijnanesvara, Mitaksara, 842-844.
Vitthala, Prakriyakaumudlprasa-
da, 315.
Grandson of Ramacandra, 824.
Vitthaladiksita, Kundamandapa-
siddhi, 798.
Vitthalesa, son of Vallabha, 94.
Vidagdhamadhava, by Rupa, 305.
Vidagdhamukhamandana, by Dhar-
madasa, 511-513.
Videhamuktyadikathana, 568.
Viddhasalabhanjika, by Rajase-
khara, 284.
*Vidyadhara, 830, 837, 106 .
Vidyadhara, father of tBhamnaji (a. n.
1750 ), 757, 95 .
Vidydnatha, Prataparudviya , 180,181.
Yidyapati, poet, 708.
Vidyapati, Gangavakyavali, 708.
Vidyaranya, Paficadadi, 540-542,
see also Madhava.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
Order of alphabet a, a, i, I, u, u, r, r, 1 : e > ai, o,au: k, k-h, g, g-h, n: c,c-h, j, j-h, ii: t, t-h, d, (j-h, n: t, -th, d, d-h, n: p, p-h, b, b-h, in:
y, r, 1 , v : £, s, s, h : ; (h), • m (m).
References are made thus:—823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
120
Vidyalamkarabhattacarya, Glosses
oi) Samksiptasaratika, 390.
VidvanmodatarahginI, by Rama-
deva, 629.
tVinnyasuiulnra (a. d. 1677 ), 570, 72 .
Vinayakabhatta, Angarejacan-
drika, 249.
Vibhramasutra, by Hemacandra,
380.
Commentary on, by Gunacandra,
380.
Vivadacandra,by Misarumisra, 718.
Vivadacintamani, by Vacaspati-
misra, 646, 647.
Vivadabhangarnava, by Jaganna-
tha, 719.
Vivahatattva, by Raghunandana,
696.
Vivahavrndavana, by Kesavarka,
791.
Visakhadatta, Mudraraksasa, 296-
300.
Yisramasukla, father of S'ivarama, 710.
Visvagunadarsa, by Venkata, 319.
Visvanatha, Jatakapaddhatyuda-
harana, 794.
Visvanatha, Nyayabhasya, 676.
Nyayasiddhantamuktavali, 579.
Bhasapariecheda, 677, 678.
Visvanatha (a. n. 1736 ), Vratapra-
kasa, 663, 664.
Visvanatha, Sahityadarpana, 510-
513.
Visvaprakasa, by Mahesvara, 428.
Vismrfqja, cited by Jimutavahana,
714.
Visvfisadevl, patroness of Vidyapati,
708.
Visvesvara, Tithinirnayasara, 651,
652.
Madanaparijata, 651, 652.
Subodhinl, 633, 634.
Smrtikaumudi, 653.
*Yisnudattnka, 804-806, 845.
Visnu Purana, 109-112.
Commentary on, by S'rldhara-
svamin, 111 .
Commentary on, by Ratnagarbha,
111 .
Visnupurl, Dvadasamahavakyavi-
varana, 557.
Bhaktiratnavali, 90, 91.
tVisnubliatta, 193.
Visnumahatmya, in Brhannara-
diya Purana, 47, 7 .
tVisnusarman (a. I). 1525 ), 520, 523.
Visnusarman, Pancatantra, 335-
337.
Visnusahasranamakathana, 28-30.
Commentary on, by S'ahkara-
carya, 30.
IXDEX
Virasimha, Mitrodaya written for,
713.'
*Viresvarabhatta, 269, 618.
Vlsaladeva, of Anhilvad, 497-
Vrttaratnakara, by Kedara, 462-
464.
Commentary on, by Janardana,
465.
Commentary on, by Bhaskara-
6 arman, 466.
Commentary on, by Narayana,
467.
Vrnda, Siddhayoga, 750, 849, 850.
Vrndavanadasa, Krsnakarnamrta-
tika, 230.
tVpidavanasannan (a. d. 1703), 391.
Vrsadova, of NepFil, 24, 4 .
Venkata, Visvagunadarsa, 319.
Venkata, S'abdarthakalpataru, 455.
Ycukatai aya (a. l). 1535 ), of Yijayana-
gara, 605.
Yenirama, father of *KubcrajI (a. d.
1798 ), 25, 31, 5 .
Venisamhara, by Bhattanarayana,
306-308.
Commentary on, by Jagaddhara,
309.
Vetalapancavim^ati, recension of
Jambhaladatta, 327.
Vedantasara, by Sadananda, 552,
553.
Vedantacarya, Gunaratnakosasto-
tratika, 235.
Yaikunthasrama, teacher of S'arnga-
dhara, 755.
Vaijala, Prabodhacandrika, 370.
Vaidyacintamani, Prayogamrta,
751.
Vaidyajivana, by Lolambaraja, 754.
Yaidyanatha , 504.
Vaidyanatha, Citrayajnanataka,
272.
Vaidyanatha Payagunde, Cidasthi-
mala, 366.
Vaitlt/ardja, Sukhaboclha, date of, 763.
Vaiyakaranabhusanasara, by Kon-
dabhatta, 402.
Vai'/dkaranasiddhiintabhusana, 402.
Commentary on, by Konda-
bhatta, 402.
Commentary on, by Nagesa, 403.
Super-commentary on, by Kr3na-
mitra, 404.
Vaisnavakutacandrika, by Ratna-
garbha, 111 .
Vaisnavi Anusmrti, 33, 34.
Vopadeva, not author of Bhagavata
Purana, 126.
Kavikalpadruma, 397.
Kavyakamadhenu, 398.
Candrakala, 756, 757.
Vopadeva—
Mugdhabodha, 394-396.
S'atasloki, 756, 757.
Harilila, 92.
*Volisena ( = AYilson), 665-667.
Vyavaharatattva, by Raghunan¬
dana, 699.
Vyavaharadidhiti, by Anantadeva,
645.
Vyavaharamayukha, by Nilakan-
tha, 655, 656.
1 . Vyakhy asudha, 1 >y S'ahkaracarya,
551.
Commentary on, 551.
2 . Vyakhyasudha, by Bhanujidi-
ksita, 416.
Yyubhiiia, father (?) of *Jayararaa, 804-
‘806.
Vyusa, 561.
Yyasatulasi, father of tl’hudeva (a. n.
1774 ), 38, 57, 59, 98, 113, 169,
22 , 186, 211, 232, 237, 31 , 240,
278, 379, 382, 386, 420, 605,
641, 649.
Yyasatrambaka, father of * Yisnudattaka,
804-806.
Vyasasukasamvada, 559.
Vratakalpadruma, by Ratnakara
(a. v. 17 14 ), 665-667.
Vratatattva, by Raghunandana,
700.
VrataprakaSa, by Visvanatha (a. d.
1736 ), 663, 664.
Vrataraja, see Vrataprakasa.
♦Walker (sir AY.), former owner of
MSS. Walker.
*Wilson (prof. H. H.), former owner of
MSS. AYilson.
S'akataropakhyana, 341.
S'akuntalopakhyana, 21.
S'akunyupakhyana, 341.
S'aktanandatarahgini, 159.
S'aktiratnakara, 157.
S'aktisahgama Tantra, 158.
S'ankara, jurist, Karmavipaka,
659.
Samskarabhaskara, 658.
S'ankava, Pradjrumnavijaya, 285.
S'ankaracetovilasa, 214.
Sankara, Rasacandrika, 254.
Sankara, S'aradatilaka, 310.
S'ahkaracetovilasa, by S'ahkara,
214.
*S'ankaradeva, 185.
tS'aiikaralala (a. d. 1815-1821), 642,
665-667.
S'ahkaravijaya, attributed to Anan-
dagiri, 624, 625.
S'ahkaracarya, Ajhanabodhinl,548.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabeta, a, i, i, u, u, r, r, 1 : e, ai, 0, au: k, k-h, g, g-h, n: c, c-h, j, j-h, n: t, th, d, d-h, n: t, t-h, d, d-h, n: p, p-h, b, b-h, in:
y, r, 1, v: s, s, s. h : : (h), • m (111).
References are made thus :—823 (2), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
INDEX
121
S'ankaracarya—
Aparoksanubhutisudharnava,
644, 646.
Atmabodha, 646, 647.
Anandalahari, 168-172.
Anandalaharistotra, 226.
GaneSabhujahga, 730.
Tripuriprakarana, 649.
Dhanyastotra, 660.
Bhagavadgitabhasya, 24.
Visnusahasranamavrtti, 30.
Vyakhyasudha, 661.
S'arirakamlmamsabhaflya, 634,
636.
(Of these works some are no doubt
incorrectly attributed to him.)
S'ankaracaryavijayadindiina, by
Dhanapati, 627.
S'ahkhaprokta Dharmafiastra, 640.
S'atadloki, by Vopadeva, 766, 767.
Commentary on, by Vopadeva,
766, 767.
8 'antanu, Candikamahatmyatika,
© 8 .
Sahara, Bhdsya, 620.
Commentary on, by Kumarila-
svamin, 620-622.
Super-commentary on, by Na-
gefia, 624.
S'abdakaustubha, by Bhattojidi-
ksita, 362.
S'abdacandrika, by Cakrapanidatta,
453.
S'abdabhedaprakaia, by Mahefiva-
ra, 429, 430.
S'abdamala, by Rame 6 vara£arman,
437, 438.
S'abdaratnakara, by Mahipa, 832.
S'abdaratnavali, by MathureSa,
439, 440.
S'abdarthakalpataru, by Venkata,
465.
S'ambhalamahatmya, from Skanda
Purana, 125.
+S>ambhunath i (a. d. 1834 ), 191.
S'ambhunatha, Kalajfiana, 753.
Sararuxdeva, Durghatavrttikrt, 356.
S'arvavarman, Katantra, 374-377.
S'akta Prayers, 146.
Sahkhayanasakhfi, 711.
S'andilyasutra, 660.
S'atatapasmpti, Karmavipaka from,
641.
S'amba, Suryastotra, 248.
S'ambapaiicaiika, 248.
S'aradatilaka (cf. J.A.O.S., XXIII, 65 -
76 ), by Laksmana Deiikendra,
160.
S'aradatilaka, by S'ankara, 310.
S'arirakamlmamsabhasya, by S'ah-
karacarya, 534, 535.
S'arirakamimamsabhasya—
Commentary on, by Govinda-
nanda, 534, 535.
S'arngadeva, Samgitaratnakara,
471-474.
S'arngadhara, Vaidyavallabha, 755.
S'arngadhara, S'arngadharapad-
dhati, 215, 216.
S'arngadhara, S'arngadharasam-
hita, 748, 749, 753.
S'afivata, Nanarthakofia, 414.
S'astradipikfi, by Parthaearathi-
mi 6 ra, 526.
S'ivakola, by S'ivadatta (a. d. 1677 ),
452.
S'ivagita, from Padma Purana, 61.
SivajI, of Mallumpakhyagaccha, 802,
101.
S'ivadatta (a. d. 1677 ), S'ivakofia,
452.
SIvadasa, father of fPitambara (a. d.
1640 ), 793.
S'ivadasa, Katharnava, 328.
Recension ofVetalapaiicavimfiati,
327.
1 . S'iva Purana, 113.
2 . S'iva Purana, 129.
Uttarakhanda, 129.
Jfianakhanc^a, 129.
S'ivarama, S'raddhacintamani, 710.
Subodhini, 710.
S'ivadityamifira, Saptapadarthi,
839.
S'i£upalavadha, by Magha, 193-
195.
Commentary on, by Mallinatha,
196, 197.
Commentary on, by Bharatasena,
198, 199.
+Sisur&madeva£arman (a.d. 1821 ), 675,
702.
S\ika, pupil of Prajyabhatta, 314.
S'ukasaptati, 330, 331.
S'uddbikaumudi, by Govindananda,
644.
S'uddhitattva, by Raghunandana,
701.
S'uddhidipika, by S'rinivasa, 792.
Svddhinirnaya, b yVdcaspatimUra, 648.
S'udraka, Mrcchakatika attributed
to, 250.
S'udrakrtyavicaratattva, by Raghu¬
nandana, 702.
S'udradharmatattva, by Kamala-
kara, 654.
S'ulapani, date of, 660.
Tithidvaitaprakarana, 662.
Tithiviveka , 679.
Praya 6 cittaviveka, 660.
S'pngaratilaka, by Rudrabhatta,
491.
S'rngara 6 ataka, by Bhartrhari, 247.
Srngdramrtalahari, by Samaraja, 273.
S'esakrsna, Kamsavadha, 271.
S'esaramacandra, see Ramacandra
S'esa.
S'aivavayaviya Purana, 129.
1 . S'raddha, 711.
2 . S'raddha, 712.
S'raddhacintamani, by S'ivarama,
710.
S'raddhamayukha, by Nilakantha,
657.
Snkrsna, father of Laksmana, 160.
S'ridharasvamin, Atmapraka£a, 111.
Bhavarthadipika, 79-87, 811,
812.
Subodhini, 25.
Smrtyarthasara, 670.
S'rlnavanagara, 752.
S'rinathaiarman, Tithidvaitapra-
karanavyakhya, 662.
S'rinivasa, Ganitacudamani, 792.
S'uddhidipika, 792.
S'ripati, Jyotisaratnamala, 782,
783.
S'ripatidatta, Katantrapari 6 ista,
374.
S'rimalamahatmya, from Skanda
Purana, 130.
S'riramapaddhati, ascribed to Rama¬
nuja, 733.
S'rivara, Jainatarangini, 314.
Srisena , version of Romaka Sid-
dhanta, 796.
Srutakdrtitraividya, Raghavapanda-
viya, imitates Kaviraja, 212 .
S'rutabodha, attributed to Kalidasa,
470, 835.
Commentary on, by Manohara-
6 arman, 835.
S'lokavarttika, by Kumarilas vamin,
520, 521.
Sayasta Khan, 452.
Samskarabhaskara,byS'ankara,658.
Samskaratattva, by Raghunandana,
707.
Samksiptasara, by Kramadi&vara
and Jumaranandin, 388, 393.
Commentary on, by Goyicandra,
389-393.
Super-commentary on, by Vi-
dyalamkarabhattacarya, 390
(frag.).*
Samksepaiankarajaya, by Madha-
va, 626-628.
Commentary on, by Dhanapati,
627.
Sahgama I, father of Kampa, 372.
Sangama II, 372.
Thiok type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t = a scribe. * = an owner.
Order of alphabeta, a, i, T, u, u, r, r, J: e, ai, 0 , au: k, k-h, g, g-h, n: c, c-h, j, j-h, fi: {, $-h, d, d-h, u: t, t-h, d, d-h, n: p, p-h, b, b-h, m :
y, r, 1, v: i, s, s, h: j (fc), ♦ m (ih).
References are made thus:—823 ( 2 ), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
BODL. SAMS. CATAL, APP. R
122
INDEX
Samgitadarpana,byDamodara, 476 -
479.
Samgitanarayana, by Narayana-
deva, 480.
Samgitaratnakara, by S'arngadeva,
471-474.
Samjivani, see Mallinatha.
Sadananda, 388.
Sadananda, Vedantasara, 552, 663.
tSadasiva (a. D. 1805 ), 541.
Sanatkumarasamhita, Ramacan-
drastavaraja from, 161.
Sanatanasarman, Meghadutatika,
218.
Samnipatakalika, 758.
Saptapadarthi, by S'ivadityami 6 ra,
839.
Sambhalpur, 125.
Sarasvatikanthabharana, by Bhoja,
489.
Commentary on, by Ratnefivara,
490.
Sarasvatiprakriya, by Anubhuti-
svariipa, 382-385.
Sarasvatisutra, 381.
Commentary on, by Anubhuti-
svarupa, 382-386.
Commentary on, by Ramacan-
drasrama, 380, 387.
Sarvamkasa, by Mallinatha, 190,
197.’
Sarvadarsanasamgraha, by Madhnva
(and Sayana ?), 622, 823.
tSabasrakirana (A. D. 1655 ), 70.
Samkhyakarika, by Isvarakrsna,
589.
Commentary on, by Narayana-
tlrtha, 569.
Commentary on, by Vacaspati-
misra, 570-573.
Samkhyacandrika, by Narayana-
tirtha, 569.
Samkhyatattvakaumudi, by Vaeas-
patimisra, 570-673.
Samkhyasutra, 574.
Commentary on, by NageSa, 574.
Sadrfiyavada, by Mahadeva, 609.
Samagavrsotsargatattva, by Raghu-
nandana, 698.
Samaraj a, Damacarita, 273.
Dhurtanartaka, 274, 275.
Samba, see S'amba.
Sayana, Madhaviyadhatuvrtti, 372.
Sarvadarsanasamgraha, 622,
623.
Sarangarangada, 231.
Sarasamgraha, 668 .
Sarasvatadipika, see Siddhasarasva-
tadipika.
Sahityadarpana, by Vi&vanatha,
510.
Sahityadarpana—
Commentary on, by Ramacarana,
511-513.
Sahudi, 660.
Sahebram , recension of Nilamata, 818.
Simhagupta, father of Vagbhata, 741,
742.
Simhasanadvatrim 6 atputrikav§rt-
ta, 320.
Siddhayoga, by Vrnda, 750,849,850.
Siddhasarasvatadlpika, by Padma-
nabha, 173.
Siddhantakaumudl , by Bhattojidiksi-
ta, 358-380.
Commentary on, by Bhattojidi-
ksita, 350-359.
Commentary on, by Jfianendra
Sarasvati, 380-304.
Super-commentary on, by Vai-
dyanatha Payagunde, 384.
Siddhantacandrika, by Ramacan-
drasrama, 386, 387.
Siddhantasamgraha, by Radhamo-
hana 6 arman, 036.
Siddhefivara Tantra, Janakisaha-
sranamastotra from, 102 .
Sukluibodha , by Vaidyaraja, date of. 763.
Sudarianakavaca, from SudarBana-
samhita, 183.
Sudar 6 anasamhita—
SudarSunakavnca, 103.
Hanumatkavaca, 184.
Hanumatpaddhati, 103.
Sundara, Abhiramamaninataka,
209, 270.
Supadma, by Padmanabhadatta,
401.
Subandhu, Vasavadatta, 332, 333.
Subodha, by Durgadasa, 395, 390.
Subodha, on S'ifiupalavadha, by
Bharatasena, 198, 199.
On Meghaduta, 218.
Subodhini, by S ivarama, 710.
SubodhinI, on Krsnakarnamrta, 230.
Subodhini, on Bhagavadgita, by
S'ridharaavamin, 25.
Subodhini, on Mitaksara, byVifive-
6 vara, 033, 834.
Subodhini, on S'rutabodha, by Ma-
noharasarman, 835.
Subhata, Dutangada, 278-278.
Surapala, Vrksayurveda, 768.
Sureivara, Paficikaranavarttika,
554.
tSuvarnaTripathin (a.d. 1782), 1 - 13 , 2.
SuSrutasamhita (cf.Hoernle, Osteology,
pp. 4 sq.; Keith, Z.D.M.G., LXH,
136 ), 738, 739.
Surya, Ramakrsnakavya, 240.
SuryamallajI, of Mallumpiikhyagaccha,
802, 101 .
Suryasiddhanta, 772.
Commentary on, by Dadabhai,
772.
Commentary on, by Bhudara,
773.
Suryastuti, 853.
Suryastotra, by S^mba, 248.
Commentary on, 248.
Sodhala (a. d. 1210), father of S'arnga¬
deva, 471.
Soma, Ragavibodha, 475.
tSomaji (a.d. 1792 ), 74.
Somadeva, Kathasaritsagara, 321-
325.
Somasnndara, of Tapapaksa, 209.
Somefivara, Nyayasudha, 522.
Saura, 720.
Skanda Purana—
Kapila Samhita, 131.
Katyayanimahatmya, 119.
Kafiikhanda, 120 - 122 .
Gurugita, 123.
Dvarakamahatmya, 124, 815,
818.
Prabhasaksetratirthayatranu-
krama, 817..
Brhadbrahmottarakhanda, 126.
Laghu 6 iva Purana, 127, 128.
S'ambhalamahatmya, 125.
S'rimalamahatmya, 130.
Stambhatirtha, 804-808, 829, 845.
SphCtrjjidhvaja, 781.
Smrtikaumudi, by Vi 6 ve 6 vara, 053.
Smrtyarthasagara, by Chalari Nr-
simha (a. d. 1682 ), 009.
Smrtyarthasara, by S'ridhara, 070.
Svapnadhyaya, from Brahmavai-
varta Purana, 808.
Svaratattvodaya, by Jxvanatha,
793.
Svatmarama, Hathapradipika, 588.
Hathapradipika, by Svatmarama,
688 .
Hanumatkavaca, from Sudarsana-
samhita, 164.
Hanumatpaddhati, from Sudar^ana-
samhita, 103.
Hanumannataka, see Mahanataka.
Hanumanagiri, 71.
Hammira, of Sfokambhari, 370.
tHara (a. d. 1825 ), 879, 088.
tHaraka (a. d. 1824 ), 818, 103 .
fHaragyana (a. d. 1754 ), 307.
tHarajit (a. d. 1647 ), 280.
fHaramjit (a.d. 1594 ), 219.
tHaralala (a. d. 1821), 204, 205.
Harasimha, prince, 708.
Harikrsna, grandfather of fDevesvara,
779. ’
Haridasa, Kusumafijalivrtti, 600.
Thick type = Sanskrit authors, or works, in the Bodleian. Italics = other authors or works. + = a scribe. * = an owner.
Order of alphabeta, a, i, i, u, u, r, r, J: e, ai, 0, au: k, k-h, g, g-h, h: c, c-h, j, j-h, n: t, t-h, d, d-h,n: t, t-h, d, d-h,n: p, p-h, b, b-h, m:
y, r, 1, v : s, s, s, h : : (h), • m (in).
References are made thus :—823 (2), 104 = MS. 823 (in this vol.), section 2 (in the MS.), p. 104 (in this vol.).
INDEX
1*2.3
Harid&aa,Lekhakamukt&ma?i,700.
IfaridVcfila, LaghtJnbdaratna, used by
writer of glosses, 800.
Haridera, father of tDeve 4 rara, 770 .
Harinitha, K&Tyidariam&ijana,
485.
Harinitha, Rftmaril&aak&vya, 241.
Harinirftyana, aee Bhaimva.
lluriniriyana (a. d. 1506), king, 048 .
11 anbhaktiviUua , 072 .
Harirftma—
DharmitftveochedakatApratyft-
•attmo&ra, 010 .
Navtnamntarioira, 011 , 012 .
Harilllft, by Vopadeva, 02.
Commentary on, by Hem&dri, 02 .
HariUUriveke, by Hem&dri, 02.
Harivaxpia, B&dh&raeaaudh&nidhi,
280
Harirapia (for date, cf. J.R.A.S .,
1907, p. 681), 10-20.
Commentary on, by HQakai^fha,
10 - 20 .
Hariyamfa—
Follows V&yu Purina, 108.
*Hari£rama (a. d. 1640), 703.
Harisimha, Mithilft prince, 708.
Harisimha (a. d. 1324), king of Nepil (cf.
J.R.A.S., 1907, p. 1084), 708, 718.
Harihara II (a. d. 1385), 44 L
tHariharananda (a. d. 1749), pupil ( 1 )
of Madhusudaninanda, 6L
Haril, 820.
Harfa,KhaQ 4 anakha 94 akh&dya(cf.
J.R.A.S., 1908 , p. 523 ), 020.
Naifadhiyaoarita, 200-207.
Harfa, Batn&vali attributed to, 803,
304.
N&g&nanda attributed to, 821.
Hal&yndha—
Abhidh&naratnam&lA, 421, 830,
SSL
Kavirahaiya, 421.
Mrtasamjivanl, 421.
Hal&yudha (a. d. 1474 ), Por&nasar-
vaeva, 143, 144.
Haetaratn&rali, by B&ghava, 483 .
tH&tha (a. d. 1817V 22 , 104 .
Harararfa, son of Vikramasfla, Yuva-
raja, 840 .
H&ay&rpara, by Jagaditrara, 311 ,
812 .
Hitopadeia, by H&r&yana, 888.
Himmativarman, lather of KamaTamuiP,
78 , 10.
Hiranyagarbhanmhita, 101.
Hemacandra—
Abhidh&nacint&mapi, 422-420.
Dh&tup&tha, 378 , 370 .
Vibhramaentra, 380 .
Hemidri, cites Smftyarthaeira,
070 .
Hariifl&yireka, 02.
Haima Dh&tup&tha, 378, 370.
Fragments, 000, 737, 858.
•Fraser (James), former owner of MSS.
Fraser.
Thlok type ~ Sanskrit authors, or works, in the Bodleian. Italics = other authors or works, t « a scribe. • = an owner.
Order of alphabet:— a, ft, i, I, u, a, r, f,l: e, ai, o, au: k, k-h,g,g-h,n : c, c-h,j, j-h,n: t, t-h,d,d-h,p: t,t-h,d,d h, n: p, p-h, b, b-h, m :
7 , r, 1, ▼: i V, s. h: : (b), * ip (*).
Befsrenoeo are made thus 823 (2), 104 — MS. 823 (in this rol.), section 2 (in the MS.), p. 104 (in this yoL).
OXFORD
PRINTED AT THE CLARENDON PRESS
BY HORACE HART, M.A.
PRINTER TO THE UNIVERSITY
Live Music
Archive
Librivox
Free Audio
Metropolitan Museum
Cleveland
Museum of Art
Internet
Arcade
Console Living Room
Open Library
American
Libraries
TV News
Understanding
9/11